KEGG   Brucella melitensis M28: BM28_B0761Help
Entry
BM28_B0761        CDS       T01852                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00071  Fatty acid degradation
bmz00280  Valine, leucine and isoleucine degradation
bmz00281  Geraniol degradation
bmz00310  Lysine degradation
bmz00362  Benzoate degradation
bmz00380  Tryptophan metabolism
bmz00410  beta-Alanine metabolism
bmz00640  Propanoate metabolism
bmz00650  Butanoate metabolism
bmz00903  Limonene and pinene degradation
bmz00930  Caprolactam degradation
bmz01040  Biosynthesis of unsaturated fatty acids
bmz01100  Metabolic pathways
bmz01110  Biosynthesis of secondary metabolites
bmz01120  Microbial metabolism in diverse environments
bmz01130  Biosynthesis of antibiotics
bmz01200  Carbon metabolism
bmz01212  Fatty acid metabolism
Module
bmz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BM28_B0761
   00650 Butanoate metabolism
    BM28_B0761
  Lipid metabolism
   00071 Fatty acid degradation
    BM28_B0761
   01040 Biosynthesis of unsaturated fatty acids
    BM28_B0761
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BM28_B0761
   00310 Lysine degradation
    BM28_B0761
   00380 Tryptophan metabolism
    BM28_B0761
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BM28_B0761
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BM28_B0761
   00281 Geraniol degradation
    BM28_B0761
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BM28_B0761
   00930 Caprolactam degradation
    BM28_B0761
Enzymes [BR:bmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BM28_B0761
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BM28_B0761
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BM28_B0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO UDPG_MGDP_dh_N F420_oxidored FAD_binding_3 NAD_Gly3P_dh_N Sacchrp_dh_NADP ApbA 2-Hacid_dh_C NAD_binding_7 Pyr_redox_2 NAD_binding_8 DFP TrkA_N GIDA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADZ68010
Position
2:complement(754034..756250)
Genome map
AA seq 738 aa AA seqDB search
MAYVNFKVETDADGIALVTWDMPEKSMNVFTVDAMQELNAIIDAVIADDKIKGVVITSGK
ETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMSGLFRKLETCGKPWVSAIN
GTCMGGAFEMSLACHARAASDAPGVKMALPEVKVGLFPGAGGTQRVPRLANQQDALQMMT
TGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLKPVQPWDEKGFKLPGGAIYSAAG
ANLWPAATAILRRETSGNYPAALAILKSVYEGLLVPFDTGLKIEQRYFTEILQTTEAGMM
IRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGAGFMGAGIAYVTAKAGIPVVLIDRDQE
SADKGKAHTADLITKEMQKGRATEADKEKLLSLITATPDYAQLEGADLVIEAVFEDREVK
RVATEKAEEVLKSSAVFASNTSTLPITGLAKVSKRPKNFIGIHFFSPVDKMMLVEVILGK
KTSDKALAVALDYVRAIKKTPIVVNDTRGFYVNRCVLRYMSEAYNMLVEGVPAAMIENAA
RMAGMPVGPLALNDETAIDLSQKILKATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNG
KGFYDYPAKPAKKHLWPGLKDLYPQQNPDTIDVKELKERFLVTIALEAARVMEEGIVTDP
READVGSILAFGFAPYTGGTLSYIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENG
ETFYQRFNPYKGETKKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgtaaatttcaaggttgaaaccgacgccgacggcattgctctcgttacatgg
gacatgcccgaaaagtcgatgaatgtcttcaccgtcgatgcgatgcaggaactgaatgca
atcatcgatgcggtgatagctgacgacaagatcaagggtgttgtcatcacctccggcaag
gaaaccttctccggcggtgccgacctgaccatgctggaaggcatgttcaaggaattccag
aagcagaaggtcaaggaccccgaaggcgcggtccagaccctgttcgacaatgtcggcaag
atgagcggcctgttccgtaagcttgaaacctgcggcaaaccgtgggtttcggccatcaac
ggcacctgcatgggcggcgcatttgaaatgtcgctcgcctgccatgcgcgtgcggcgtcc
gatgcgccgggcgtgaagatggccctgccggaagtgaaggtcggccttttccccggtgct
ggcggcacgcagcgcgttccgcgccttgccaaccagcaggacgcgcttcagatgatgacg
acgggttcaagcctcaccgcgcagcgcgccaaggctatgggccttgtcaccgagattgct
ccggccaagaagctggtcgaaacagccaagaagctcatcaagggtggcctcaagccggtt
cagccctgggatgaaaagggcttcaagctgccgggcggcgcgatttattcggctgccggt
gcaaacctctggcctgccgcgaccgccatcctgcgtcgcgaaacatcgggtaattatccg
gcggcactcgccattttgaagtcggtttatgagggccttctggtgcctttcgacaccggc
ctcaagattgaacagcgctatttcaccgaaatcctccagacgaccgaagcgggcatgatg
atccgctcgctcttcgtgtcgttgcaggagttgaacaagggtgcgcgccgtccggttgac
gaaaagccgaccaggctcaagaagatcggcgtcatcggcgcgggcttcatgggtgcaggc
attgcctatgtgacggcgaaggccggtattccggtcgtgctgatcgaccgcgatcaggaa
tctgccgacaagggcaaggcccacacggcagacctaatcaccaaggaaatgcagaagggc
cgtgccaccgaggccgacaaggaaaaacttctgtcgctcatcacagcaacgccggattat
gcccagcttgaaggtgctgatctggtgattgaagccgtgttcgaggaccgcgaagtcaag
cgcgttgcgaccgagaaggccgaggaagtgctgaaatcttccgcagtcttcgcctccaac
acctcgaccctgccgatcaccggtcttgccaaagtgtcgaagcgtccgaagaattttatc
ggcatccacttcttctcgcctgtcgacaagatgatgctggtggaagtgatcctcggcaag
aagacctctgacaaggcattggccgtagcactcgattatgtccgtgcgatcaagaagacg
ccgatcgtcgtcaacgatacgcgcggcttctacgtcaaccgttgcgtgctgcgctatatg
tcggaagcctacaacatgcttgttgaaggcgtcccggcggcgatgatcgaaaatgccgcc
cgcatggccggtatgccggtcggcccgcttgcgctcaacgacgaaacggccatcgacctg
tcgcagaagatcctgaaagccacgcttgccgatcttggtccgaaggccgttgacccgcgc
catgtggaattggtggacaagcttgtcaacgagttcgaccgcaagggccgcaagaatggc
aagggcttctacgattatccggcaaagcctgccaagaagcatttgtggccgggtctgaaa
gacctctatccgcagcagaacccggacacgatcgatgtgaaggagcttaaagagcgcttc
ctcgtcaccatcgctctggaagctgcccgcgtgatggaagaaggcattgtgaccgatccg
cgtgaagccgatgtcggctccatcctcgccttcggtttcgcgccttatacgggcggcacg
ctctcctatatcgacggtatgggcgcgaagaaattcgtccagctcgccaaggatttgcag
aagaaatatggcgcacagttcaaggcgccgaagcttctgctcgatatggccgagaacggc
gaaaccttctaccagcgtttcaatccctataagggcgaaacgaaaaaagcagcctga

DBGET integrated database retrieval system