KEGG   Brucella melitensis M28: BM28_B1054Help
Entry
BM28_B1054        CDS       T01852                                 

Definition
putative L-fuculose-1-phosphate aldolase subunit P
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bmz  Brucella melitensis M28
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BM28_B1054
Enzymes [BR:bmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BM28_B1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1038746..1039405)
Genome map
AA seq 219 aa AA seqDB search
MQMNCDSALLARQSIVDAMRSFEEKGFNHGSSGNISVREGGHIWVTPTGATSTMDPQDMS
LVSLEGEHLAGKIPSSEWRIHTEIMRAHPEAGAVVHSHADACVALSCLRKPLPPFHYMIA
SFGGSEVPCASYRVFGSDALAYEVVRAMGHHRACLMASHGMVVWGRDLAHARLLAEKLET
LARQYILACQIGTPALLSDVELTEVRERYGFYGSQPMPR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgaattgcgattcggcccttttggcccgacagtccatcgtggatgcgatgcgg
tcttttgaggaaaagggattcaatcatggcagcagcggcaacatcagtgttcgggaaggc
gggcatatttgggtgacgccaacgggcgcgacctcgactatggacccgcaggacatgagc
cttgtctcccttgaaggcgagcatctggctggcaaaattccctccagcgaatggcgtatc
cataccgaaatcatgcgggcgcacccggaagccggtgccgtggtccattcccacgcagat
gcctgcgtggcgctttcctgcctgcgcaagccccttccgccattccattacatgatcgct
tccttcggcgggagcgaggtgccttgtgcgtcatatcgcgtattcggatcggacgcgctg
gcttatgaagtcgtgcgtgcgatggggcaccatcgcgcctgtctgatggcaagccacggc
atggtggtgtgggggcgggatctcgcacatgccaggctccttgcagaaaagctcgaaacg
ctggcacggcaatatatattggcctgccagatcggaacacccgccctgttgagcgatgtc
gaactgacggaagtccgggaacgctacggtttttacggcagccaacccatgccgcgctga

DBGET integrated database retrieval system