KEGG   Brucella melitensis M28: BM28_B1085Help
Entry
BM28_B1085        CDS       T01852                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00010  Glycolysis / Gluconeogenesis
bmz00020  Citrate cycle (TCA cycle)
bmz00620  Pyruvate metabolism
bmz01100  Metabolic pathways
bmz01110  Biosynthesis of secondary metabolites
bmz01120  Microbial metabolism in diverse environments
bmz01130  Biosynthesis of antibiotics
bmz01200  Carbon metabolism
Module
bmz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM28_B1085 (acoC)
   00020 Citrate cycle (TCA cycle)
    BM28_B1085 (acoC)
   00620 Pyruvate metabolism
    BM28_B1085 (acoC)
Enzymes [BR:bmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BM28_B1085 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Biotin_lipoyl Abhydrolase_1 E3_binding Biotin_lipoyl_2 Hydrolase_4 RnfC_N HlyD_3 Thioesterase Ser_hydrolase Ndr NQRA HlyD_D23 UPF0227 DUF1100 PAF-AH_p_II
Motif
Other DBs
NCBI-ProteinID: ADZ68334
Position
2:complement(1071019..1072305)
Genome map
AA seq 428 aa AA seqDB search
MATEILYPKVSLETNSGTISRWHVQDGDAVEQGQILFEIDNDKTVVEVDAPHAGTVKILK
SSTTDEIEVGQSVASLFAKGETITAPPAPAAAQNASAPKTADILAVVNKGQNGRAIATPL
ARRLANDAGIDLDRIGGTGPGGRIQKKDVIAALQSCPSIPETIAASRQARPEGDCLLNAV
WLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLAIDLPSHGASPLVAVTSLDAIAA
MIEATLKALDIQRAILVGHSFGAAVSARLANRGNIDIRALGLFSPAGLGPEINVGFVQNF
VRARARESVTPWLHELVHDKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVS
ILDDLASLEIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRILA
EVSASAAG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaattctatatccaaaagtcagtctggaaaccaattccggaacgatttcg
cgttggcacgtccaggatggtgacgcggtcgaacagggccagatcctgttcgagatagac
aatgacaagacagtcgtggaggttgatgcgccgcatgccggaacggtaaagatactgaaa
tcttccaccaccgatgaaatcgaggtcggccagagcgtcgccagcctgtttgccaaggga
gaaacgatcaccgcgcctcccgcaccggccgcagcgcaaaatgcatcggcgccaaaaacg
gcggatatattggcggtcgtcaataaaggtcaaaatggcagggccattgcgacacctctt
gccaggcgcctggccaatgatgccgggatcgaccttgaccggatcggcggcaccggccca
ggcgggcgcatccagaagaaggatgtcattgcagcattgcaaagctgcccatccattccc
gaaaccattgctgcttcgaggcaggcgcggccggaaggcgattgcctgcttaatgccgtg
tggctgcgcaagggcgaagggacgccgcttgtgctgttgcacggctttgcctcggaccac
aacaactggcgggggctttttgccggcacacaatggcaacagcccttgctggcgattgat
ctgccctcccatggcgcttccccgctcgtcgccgtcacgagccttgatgcgattgccgcg
atgatcgaggccacactcaaggccctcgatatccagcgtgcgatccttgtgggccattcc
tttggcgcagccgtcagtgctcgccttgccaatcgcggcaatatcgacatccgcgccttg
ggcctgttttcgccagccgggctcggtccggaaatcaatgtcgggttcgtccagaacttc
gttcgggcaagggcgagggaaagtgtgaccccgtggctgcacgagcttgtgcacgacaag
gccagcatttccgatactttcatcaaggccgtcgtgcagcagcgccaggataacgatctg
agcgacgccatgatggcattttccgaacatttcttcgccgacggcacgcagaccgtctcc
attctcgacgatctcgcctcgctcgaaattcccgtccgcgtcatttacggcaggcaggac
aggatattgccgttccgctacacccggaacctgcccgacaatgtcgcgctgtatgcgttc
gatgcttgcgggcacatgccgcatctggaaaagcgcggcctgagcctgcgcatcctggcg
gaggtttccgcctccgcggcaggctga

DBGET integrated database retrieval system