KEGG   Brassica napus (rape): 106381362Help
Entry
106381362         CDS       T04128                                 

Definition
(RefSeq) protein STRICTOSIDINE SYNTHASE-LIKE 12-like
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
bna  Brassica napus (rape)
Pathway
Indole alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    106381362
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     106381362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
C2
AA seq 327 aa AA seqDB search
MMSFFSIISLLLLLFSLSSVVISDGESFQKLPVPENRSGPEAFAFDSTGKGFYTGVSGGK
ILKYTPETGYVDFAQITESNSSWCDGVVGTALAGRCGRPAGIAFNEKTGELYVADAPLGL
HVVSPAGGLAVKIADSVDGKPFKFLDGLDVDPTTGVVYFTSFSSRYTPIQVLIALGLKDA
TGKLFKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGPKAGSSE
DFTNSVSNPDNIKRIGSTGNFWIASVVNKIVVPTNPSAVKVNSNGEVLQTIPLKDQFGDT
LLSEVNEFDGSLYIGTLTGPFAGVLKL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcatttttctccataatttctctcctgcttcttcttttctctttgtcgtcggtg
gttatctcggatggcgagtcttttcagaaacttccggtgccggaaaataggtcaggtcct
gaagctttcgcctttgactccaccggaaaaggattctacaccggagtctctggtggaaaa
atactgaagtatactcctgagacgggttatgtcgattttgcacagatcacagaatcgaac
tcttcatggtgcgatggtgtagtcgggacggctttagccggaagatgcggtcgaccggcg
gggatagccttcaatgaaaaaacaggtgagctctacgtcgccgatgcaccgttgggtctt
cacgttgtgtctcccgccggtggcttggccgtaaaaatcgccgacagtgttgatggaaag
ccctttaaatttctcgacggtcttgacgttgatccaactactggtgtcgtgtacttcact
tccttcagctcacgctataccccaattcaagtgttgattgcattgggattaaaggacgcg
accggaaaactcttcaagtacgatccatcaacaaaggtcgtgaccgtattaatggaaggt
ttaagtggctcagctggttgtgccgtgagctcggatggttcgttcgtgcttgtcagtcag
ttcacaaagagtaacatcaagaggtattggatcaagggacctaaagctggttcatctgaa
gacttcacaaactcggtctcaaaccctgacaatatcaagaggattggttctacaggaaac
ttttggatcgcttcggttgtgaacaagatcgttgtgccgacaaacccatcagcggtcaaa
gtgaactccaatggtgaagtgcttcaaacaattcctctaaaagatcaatttggggacact
ttgcttagcgaagttaacgaattcgatggtagtttatacatcgggactctcactggccct
tttgctggagttcttaagctttaa

DBGET integrated database retrieval system