KEGG   Brassica napus (rape): 106385410Help
Entry
106385410         CDS       T04128                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV4-like precursor
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bna  Brassica napus (rape)
Pathway
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106385410
   00500 Starch and sucrose metabolism
    106385410
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106385410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C PepSY_like
Motif
Other DBs
NCBI-GeneID: 106385410
NCBI-ProteinID: NP_001302482
UniProt: A0A0F6T806
AA seq 590 aa AA seqDB search
MGVSSIISVMLLLVLINLGNNIKGIEAFHQVYEKLQSQSVESVNHLHRSAFHFQPPKHWI
NDPNGPLYYKGFYHLFYQYNTKGAVWGNIVWAHSVSKDLVNWEALEHAIYPSKWFDIKGT
WSGSITLVPGKGPVILYTGINQNETQIQNYAIPEDPSDPYLRKWIKPDDNPVAVPDYTMN
GSDFRDPTTAWFSKDGHWRTVVGSRRKHRGIGYIYRSKDFKHWVKAKHPIHSKESTGMWE
CPDFFPVSTTDFENGLDLDYAGPNAKHVLKVSLDMTRYEYYTLGKYYPNKDRYVPNGESP
DGWDGLRFDYGNFYASKTFFDYKKNRRILWGWANESDTVEDDISKGWAGLQVIPRTVLLD
STNKKQLVFWPIEEIESLRSSYVRMNNKDIKMGQRLEVKGITPAQADVEVTFNVGSLEKA
EPFDPSYTYKPLDLCRVKGSNVTGGVGPFGLITLATPDLEEYTPVFFRVFKDTSTNKPKV
LMCSDARPSSLKQDRGPLKQDRMYKPPFAGFVDVDLTDGRISLRSLIDHSVVESFGALGK
TVITSRVYPIKAVKENAHLYVFNNGTQTVNVESLDAWSMERPLQMNNGAT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctcaagtattatttctgtgatgttattgcttgtactaatcaatttaggcaat
aatatcaaaggaattgaggcttttcatcaagtttatgaaaaattgcagtctcagtcagtt
gagtcagtgaatcatcttcacagatccgcttttcactttcaacctccaaagcattggatt
aacgatccaaatggtccattgtactacaaaggtttctaccatctcttctaccaatataac
accaaaggtgcagtttggggtaatattgtgtgggcgcattcggtttcaaaagacttggtg
aattgggaggctcttgaacatgccatctatccctccaaatggttcgacatcaaaggtaca
tggtccggttcaataacactcgtaccgggaaaaggaccggttatcctctataccggcatt
aaccaaaacgaaactcaaatccaaaactacgcaatcccggaggatccctcagacccatac
ctaagaaaatggattaaaccagatgataatccggttgcagtgccagattataccatgaat
ggttcagactttcgtgacccaaccacggcctggttctccaaagatggacattggagaacc
gtcgtggggtcaagaagaaagcatagaggaatcggatatatctacagaagcaaagatttt
aagcattgggtcaaagctaagcaccctatccactccaaagaatccaccggtatgtgggaa
tgtcctgacttcttcccggtttccacaaccgattttgagaacggtttggacttagattac
gccggtccaaacgctaagcacgtgttgaaagttagcttggacatgacacggtacgagtat
tacacgcttggcaaatactatcctaacaaggaccgttatgtaccaaacggtgaatcgcca
gatggttgggacggtttaagatttgattacggtaacttctatgcctccaagacattcttt
gactacaaaaagaacagaagaatcttgtggggttgggctaatgaatctgacaccgttgaa
gatgatatatccaagggctgggctggtcttcaggtaattccaagaacggtgcttcttgac
tcaacaaacaagaagcaactagtgttttggcctattgaagaaatagagtcattaagaagt
agttatgtccgaatgaacaacaaagacatcaagatgggtcaacgcttagaagtcaaagga
atcactcctgcccaggccgatgtggaagtgacattcaacgttggaagtctagagaaagct
gagccattcgacccgagctacacatacaaaccgttagatttgtgtagagtgaaaggctcg
aacgtgacaggtggtgttggaccttttggtctgatcacattagccacccctgatctggaa
gagtacactcctgtcttctttagagtcttcaaagacacttccacaaataagcctaaggtc
ctcatgtgctccgatgctagaccttcgtccttaaagcaagacaggggtccactcaaacaa
gataggatgtataagccaccatttgctggttttgtggatgttgacctaactgatggaagg
atctctctaaggagtttgattgaccattcggtagtagagagctttggagcgttagggaag
acagtgataacgtcaagagtgtatccgataaaagcagtgaaagagaatgcacatttgtat
gtgtttaataatggaacacaaactgtgaacgtagagagtcttgatgcttggagcatggag
aggcctttgcagatgaataatggagctacttag

DBGET integrated database retrieval system