KEGG   Brassica napus (rape): 106392374Help
Entry
106392374         CDS       T04128                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV4-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bna  Brassica napus (rape)
Pathway
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106392374
   00500 Starch and sucrose metabolism
    106392374
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106392374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C PepSY_like
Motif
Other DBs
NCBI-GeneID: 106392374
NCBI-ProteinID: XP_022548595
AA seq 537 aa AA seqDB search
VAFSTIPIDPNGPLYYKGFYHLFYQYNTKGAVWGNIVWAHSVSKDLVNWEALEHAIYPSK
WFDIKGTWSGSITIVPGKGPVILYTGINQNETQIQNYAIPEDPSDPYLRKWIKPDDNPVA
VPDYTMNGSDFRDPTTAWFSKDGHWRTVVGSRRKHRGIGYIYRSKDFKHWVKAKHPIHSK
ESTGMWECPDFFPVSTTDFENGLDLDYAGPNAKHVLKVSLDMTRYEYYTLGKYYPNKDRY
VPNGESPDGWDGLRFDYGNFYASKTFFDYKKNRRILWGWANESDTVEDDISKGWAGLQVI
PRTVLLDSTNKNQLVFWPIEEIESLRSSYVRMNNKDIKMGQRLEVKGITPAQADVEVTFN
VGSLEKAEPFDPSYTYKPLDLCRVKGSNVTGSVGPFGLITLATPDLEEYTPVFFRVFKGT
SINKPKVLMCSDARPSSLKQDRGPLKQDRMYKPPFAGFVDVDLTDGRISLRSLIDHSVVE
SFGALGKTVITSRVYPIKAVKENAHLYVFNNGTQTVNVESLDAWSMERPLQMNNGAT
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggcattctcgaccatcccaatagatccaaatggtccattgtactacaaaggattctac
catctcttctaccaatataacaccaaaggtgcagtttggggtaatattgtgtgggcgcat
tcggtttccaaagacttggtgaattgggaggctcttgaacatgccatctatccctccaaa
tggttcgacatcaaaggtacatggtccggttcaataacaatcgtaccgggaaaaggaccg
gttatcctctataccggcattaaccaaaacgaaactcaaatccaaaactacgcaatcccg
gaggatccctcagacccatacctaagaaaatggattaaaccagatgataatccggttgca
gtgccagattataccatgaatggttcagactttcgtgacccaaccacggcctggttttcc
aaagacggacattggagaaccgttgtggggtcaagaagaaagcatagaggaatcggatat
atctacagaagcaaagattttaagcattgggtcaaagctaagcaccctatccactccaaa
gaatccaccggtatgtgggaatgtcctgacttcttcccggtttccacaaccgattttgag
aacggtttggacttagattacgccggtccaaacgctaagcacgtgttgaaagttagcttg
gacatgacacggtacgagtattacacgcttggcaaatactatcctaacaaggaccgttat
gtaccaaacggtgaatcgccagatggttgggacggtttaagatttgattacggtaacttc
tatgcctccaagacattctttgactacaaaaagaacagaagaatcttgtggggttgggct
aatgaatctgacaccgttgaagatgatatatccaagggctgggctggtcttcaggtaatt
ccaagaacggtgcttcttgactcaacaaacaagaatcaactagtgttttggcctattgaa
gaaatagagtcattaagaagtagttatgtccgaatgaacaacaaagacatcaagatgggt
caacgcttagaagtcaaaggaatcactcctgcccaggccgatgtggaagtgacattcaac
gttggaagtctagagaaagctgagccattcgacccgagctacacatacaagccgttagat
ttgtgtagagtgaaaggctcgaacgtgacaggtagtgttggaccgtttggtctgatcaca
ttagccactcctgatctggaagagtacactcctgtcttctttagagtcttcaaaggcact
tccataaataagcctaaggtcctcatgtgctccgatgctagaccttcgtccttaaagcaa
gacaggggtccactcaaacaagataggatgtataagccaccatttgctggttttgtggat
gttgacctaactgatggaaggatctctctaaggagtttgattgaccattcggtagtagag
agctttggagcgttagggaagacagtgataacgtcaagagtgtatccgataaaagcagtg
aaagagaatgcacatttgtatgtgtttaataatggaacacaaactgtgaacgtagagagt
cttgatgcttggagcatggagaggcctttgcagatgaataatggagctacttaa

DBGET integrated database retrieval system