KEGG   Brassica napus (rape): 106452309Help
Entry
106452309         CDS       T04128                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
bna  Brassica napus (rape)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106452309
   00500 Starch and sucrose metabolism
    106452309
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106452309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 584 aa AA seqDB search
MTKEVNSKIGVWLLFTLIISNYYVVDLEASHHVYKRLTQSTNIKSPSVNQPYRTGFHFQP
PKNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWDPHPAAIFPSEPF
DINGCWSGSATILPDGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLVEWTKSPLNPLMAP
DAVNGINASSFRDPTTAWLGHDKKWRVIIGSKIHRRGLAITYTSKDLLKWEKSTEPLHYD
DGSGMWECPDFFPVTRFGSKGVETSSFGEPNEVLKHVLKVSLDDTKHDYYTLGTYDRVGD
KFVPDKGFKMDSSAPRYDYGKYYASKTFYDSAKNRRILWGWTNESSSVEDDVEKGWSGIQ
TIPRKIWLDRSGKQLIQWPVREVERLRTNQVNLRNKVLDSISRLEVYGVTAAQADVEVLF
KVRDLEKADVIEPSWTDPQLICSQMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKAR
QNSNKYVVVMCSDQSRSSLKEDNDKTTYGAFVDVNPRQPLSLRALIDNSVVESFGGRGRA
CITSRVYPKLAIGKGSHLYAFNYGSQSVDVLSLSAWSMKSAQIS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaagttaactccaagattggagtttggttgttattcaccttaattattagt
aattactatgtcgtcgatctcgaagcctcacaccatgtctacaagagacttacccaaagc
actaacatcaaatctccttctgtaaaccagccctaccggaccggcttccattttcaacca
cccaaaaactggatgaacgatccaaatggccctatgatatacaaaggaatatatcatctt
ttctaccaatggaacccgaaaggcgccgtgtggggtaacatcgtgtgggcccattccacg
tcaacagatttaatcaactgggacccacatcctgcagccatcttcccatctgagccgttc
gatatcaacggatgctggtccggttcggctacaattctccccgacggcaaaccggttatc
ctctataccggaatcgaccccaagaaccaacaggtccaaaacatagccgaacctaaaaat
ctctccgacccatatctcgttgaatggaccaagtcgccgttaaatcctctgatggctcct
gacgccgtcaacggaatcaacgccagctcgttccgtgacccaaccaccgcgtggcttggc
cacgacaagaaatggagagtgatcatcggaagcaagatccaccgtcgtggactagcgatc
acttacacgagcaaagacttactaaaatgggaaaaatctaccgagccgttacactacgac
gacggaagtggaatgtgggagtgtcctgattttttccccgtgactaggtttggctccaaa
ggcgttgaaacgtcgtcttttggtgaacctaatgaggttttaaaacacgtgttgaaagtt
agcttggacgacacgaaacatgattattacactctcggtacgtacgatagggttggagat
aagttcgtacccgacaagggttttaagatggacagttcggctcctagatacgattacgga
aagtactatgcgtcgaaaacgttttatgactcagccaagaaccggagaatattgtggggt
tggactaacgaatcatcatcggttgaggatgatgtcgagaaaggctggtccggtattcag
acgattccgaggaaaatttggcttgatcggtccgggaaacagttgattcaatggccggtt
agggaagtagagagattacgtacgaatcaagtcaacttacggaacaaagttctagattca
atatctagactagaagtctatggtgtgacagctgcacaggcagatgtggaggttttgttc
aaagtgagagatttggagaaagcggatgtgatagaaccgagttggactgatccacagttg
atatgtagtcagatgaatgtatcagttaagtccggtttaggtccattcggtttaatggtt
ctcgcatctaagaacttggaagagtacacatcggtttactttagaatcttcaaagcccga
cagaatagcaataagtacgttgtggtcatgtgcagtgaccaaagcagatcttcactgaag
gaagataatgacaaaacaacctatggagcttttgtggatgttaatcctcgccaaccactc
tccctcagagccttgattgataattcagtagtggagagtttcggtggaaggggaagagca
tgcattacctccagagtgtatccaaaactggcaataggaaaaggttcacatctatatgcc
tttaattatgggtctcaaagtgtggatgtcttaagcctaagcgcttggagcatgaagtct
gcccaaatcagttga

DBGET integrated database retrieval system