KEGG   Bacillus cereus NC7401: BCN_0015Help
Entry
BCN_0015          CDS       T01686                                 

Definition
deoxynucleoside kinase family protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bnc  Bacillus cereus NC7401
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BCN_0015
   00240 Pyrimidine metabolism
    BCN_0015
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BCN_0015
    2.7.1.76  2'-deoxyadenosine kinase
     BCN_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22339..23007)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatatcccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattagctaacgctttagggtatcgcacg
tcatttgaaaaggtagattctaacccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtatactttttagcagaacgatttaaagaacaaaaaagaatt
tttgaatacggcggcggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaaaggtacaatgacggaaactgattatgaaacatacaaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagatttactcatttactta
gaaggttctttcgatgatatcgttgatcgtatccaagaacgtggacgtccgatggaacag
caaacaccaattgagtattggaaagagatgcatgggcgttatgaaaactggattaataac
tttaattcatgccctgttttaagattaaacattaatgaatatgatattttaaaagatggt
gattccattgaaccaatcattaaaaaaatcggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system