KEGG   Bacillus cereus NC7401: BCN_0341Help
Entry
BCN_0341          CDS       T01686                                 

Definition
M20/M25/M40 family peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bnc  Bacillus cereus NC7401
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCN_0341
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCN_0341
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BCN_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
382436..383584
Genome map
AA seq 382 aa AA seqDB search
MVIDILKDIVKINTANPGGNTKDLINYIIKKINKYDFEYEIFKTSESKVNLIIKVRGKVN
KTVVLNGHLDTKPYGNMNEWKYDPYAATEENKRIYGLGACDMKAGVASMITLLCTIGEEK
LIPRWNLEFHFVDDEENNSTYGMKSLLNSNILQRDLYDLAVVCEPTENSLVLESLGNSWK
IIKVKGKKAHAGHYEEGVNANEVLANVLIKAQKKISKMKGENPSFPMFPNINIGIFKGGD
HPGSVTDYSEAVIDIRVSKEFEKKMILEEIENVLEEYDVHYQINDYLPEMYSWDYKNLST
EFSSECLNILMDKFKDTFKQVIAKNKFYGGSDAGYYAEKLGVPTIIFGPGSLQQAHQPNE
WVNIKGVMDHFKILQKWMIDID
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtaatagatattctaaaggatatagtgaaaattaatacagctaatcccggtgggaat
acaaaagacttaataaattatattataaaaaaaataaataagtatgattttgaatatgaa
atatttaagaccagtgagtcaaaagtcaatttaattataaaagtaagaggtaaagttaat
aaaacagttgtgttgaatggtcatcttgatacaaagccttatggaaatatgaatgaatgg
aagtacgatccatatgctgctactgaagagaacaagcgtatctatggtttaggtgcatgt
gatatgaaggcaggagtagcttctatgattactcttttatgtacaataggggaagaaaaa
ttaattccaaggtggaatttagaatttcattttgtagatgatgaggaaaataatagtaca
tatggaatgaagagtttgttaaattcgaatattttacagagagatttgtatgatttagca
gttgtgtgtgaacctactgaaaatagtctagtattagaatctttggggaattcttggaag
ataattaaagtaaaggggaagaaagcccatgctggccattatgaagaaggggtaaacgct
aacgaagtattggcaaatgtattaataaaggctcagaagaaaatcagcaaaatgaaagga
gaaaatccatcttttccaatgttccctaatattaatataggaattttcaaaggtggagat
catccaggatctgtaacggattattctgaagctgttatagacattagggtaagtaaagag
tttgaaaaaaagatgatattggaagaaatagaaaatgttcttgaagagtatgatgtgcat
tatcaaatcaatgattaccttccagagatgtattcatgggattataaaaatttatcaact
gaattttcaagtgagtgtttaaacatattaatggataaatttaaagatacttttaagcaa
gttatagcaaaaaataaattttatggtggctccgatgctggctattatgccgaaaaatta
ggggttcctactattatttttggtccaggtagtttacaacaggctcatcaaccaaatgaa
tgggtcaatattaaaggtgttatggatcattttaagattttacagaaatggatgattgat
attgattga

  All links  
No link information was found.   
DBGET integrated database retrieval system