KEGG   Bacillus cereus NC7401: BCN_0642Help
Entry
BCN_0642          CDS       T01686                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bnc  Bacillus cereus NC7401
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCN_0642
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BCN_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710868..711764
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGDDNYGTVVRKNLENERVFIDYVVPVTDAATGIAHIVLAEEDNSIVVVQGANALVNESV
VNRSKDLLIKADMVVLQLEIPLETVKYVLAICEEHKIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEELLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagtatttcaatggacttagtggccgtttcaaaaaaa
cgtccgaaagcaggggaaacagtaattggtgaagcatttcatacaattccaggagggaaa
ggagctaaccaggcggttgctgcagctagattaggcgcaaatgtagcgatggttggagcg
gtaggagacgataattatggaactgtagttagaaaaaatttagagaacgaacgcgttttt
atcgactatgtggtaccggttacagatgcggcgacaggaattgctcatatcgttttagca
gaagaggataacagtattgttgtcgtgcaaggagcgaatgctcttgtcaatgagtcggtt
gtaaatcgttcaaaagatcttcttataaaagctgatatggttgtgcttcaactagagatt
ccgcttgaaacagtaaaatatgtattagctatttgtgaggaacacaaaatcccggttatg
ttaaacccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acgccaaatgaacatgagtgtcgcatcgtattagatgatttcacatcaccaattgaagag
ttactggctaaatatccaaacaaactattgatgacagaaggttctaacggtgtacgtttc
cataatggtacggagattgtacatgttcctagcattgctgttgatgtagtagatacgact
ggagctggtgatacatttaatggtgcattagcagttgcgctttctgaaggagaaacactt
caaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacgaagcttggagca
caaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgattgtcggatga

DBGET integrated database retrieval system