KEGG   Bacillus cereus NC7401: BCN_0953Help
Entry
BCN_0953          CDS       T01686                                 

Definition
dihydroxyacetone kinase family protein
Orthology
K00863  
dihydroxyacetone kinase [EC:2.7.1.29]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycerolipid metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bnc01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bnc00680]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bnc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1026651..1027649)
Genome map
AA seq 332 aa AA seqDB search
MKKIMNDVQNIVQDMMHGFYFEHNDKVNYDETNNIIYVKDIEKTKQGVVIISGGGSGHEP
ADIGYVGKGMLTAAVNGSIFTPPTVEQIVAATRLMPKEKSILFIIKNFKDDVANFLAAEQ
IAKEEGRQIDHIIVNDDVSIEDDASFNKRRRGVAGTVFVQKILGAAALEGHSLEELTALG
RSITENLHTLGVALSPANDPVKGQASFTLNEDEVFYGVGIHGEKGYRKEALSSSEILAIE
LMNKLKSIYRWRKGDNFAILINGLGATPLMEQYIFANDIRRLCELEGLQVTFVKVGTLLT
SLDMKGVSLSLLKIEDLDWVKWLKENTETASW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattatgaatgatgtacaaaatatcgttcaagatatgatgcatggcttttat
tttgaacataacgacaaagtaaattacgacgaaacaaataacatcatttatgtaaaagat
atcgaaaaaacgaagcaaggcgttgtcattataagcggaggtggtagcggacacgagcct
gctgatattggttatgtaggaaaaggaatgcttacggcggccgtaaacggcagcatcttc
actccgcctacagtggaacaaattgtggcggcaactcgcctcatgccaaaagaaaaaagt
atactattcatcataaaaaactttaaagatgacgtagctaactttttagcggcagaacaa
atcgcaaaagaagaaggaagacaaattgaccacatcatcgtaaatgacgacgtttcaatt
gaagatgatgcttcttttaataaaagaagacgcggcgtcgctggtactgttttcgttcaa
aaaatattaggtgcggccgctcttgaaggtcattctttagaagaactgactgcactcggc
cgttctatcactgaaaacttacacacattaggagtcgccctttcacctgccaacgatccg
gtgaaaggacaagcttcattcacattaaacgaagatgaagtcttttacggcgtcggtatt
cacggcgaaaaaggttaccgtaaagaagcactatcctcttctgaaatattagcgattgaa
ctaatgaacaaacttaaaagcatttatcgctggagaaaaggcgacaacttcgccatcctt
attaatggactcggcgcaacacctttaatggaacaatacattttcgcaaatgacattcgt
cgtttgtgtgagctggaaggattacaagttacattcgtaaaggtcggtacactgttaact
tctttagatatgaaaggtgtttcactcagtttgcttaagatagaggatttggattgggtg
aagtggttgaaagaaaatacggaaactgctagttggtaa

DBGET integrated database retrieval system