KEGG   Bacillus cereus NC7401: BCN_0953Help
Entry
BCN_0953          CDS       T01686                                 

Definition
(GenBank) dihydroxyacetone kinase family protein
Organism
bnc  Bacillus cereus NC7401
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1026651..1027649)
Genome map
AA seq 332 aa AA seqDB search
MKKIMNDVQNIVQDMMHGFYFEHNDKVNYDETNNIIYVKDIEKTKQGVVIISGGGSGHEP
ADIGYVGKGMLTAAVNGSIFTPPTVEQIVAATRLMPKEKSILFIIKNFKDDVANFLAAEQ
IAKEEGRQIDHIIVNDDVSIEDDASFNKRRRGVAGTVFVQKILGAAALEGHSLEELTALG
RSITENLHTLGVALSPANDPVKGQASFTLNEDEVFYGVGIHGEKGYRKEALSSSEILAIE
LMNKLKSIYRWRKGDNFAILINGLGATPLMEQYIFANDIRRLCELEGLQVTFVKVGTLLT
SLDMKGVSLSLLKIEDLDWVKWLKENTETASW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattatgaatgatgtacaaaatatcgttcaagatatgatgcatggcttttat
tttgaacataacgacaaagtaaattacgacgaaacaaataacatcatttatgtaaaagat
atcgaaaaaacgaagcaaggcgttgtcattataagcggaggtggtagcggacacgagcct
gctgatattggttatgtaggaaaaggaatgcttacggcggccgtaaacggcagcatcttc
actccgcctacagtggaacaaattgtggcggcaactcgcctcatgccaaaagaaaaaagt
atactattcatcataaaaaactttaaagatgacgtagctaactttttagcggcagaacaa
atcgcaaaagaagaaggaagacaaattgaccacatcatcgtaaatgacgacgtttcaatt
gaagatgatgcttcttttaataaaagaagacgcggcgtcgctggtactgttttcgttcaa
aaaatattaggtgcggccgctcttgaaggtcattctttagaagaactgactgcactcggc
cgttctatcactgaaaacttacacacattaggagtcgccctttcacctgccaacgatccg
gtgaaaggacaagcttcattcacattaaacgaagatgaagtcttttacggcgtcggtatt
cacggcgaaaaaggttaccgtaaagaagcactatcctcttctgaaatattagcgattgaa
ctaatgaacaaacttaaaagcatttatcgctggagaaaaggcgacaacttcgccatcctt
attaatggactcggcgcaacacctttaatggaacaatacattttcgcaaatgacattcgt
cgtttgtgtgagctggaaggattacaagttacattcgtaaaggtcggtacactgttaact
tctttagatatgaaaggtgtttcactcagtttgcttaagatagaggatttggattgggtg
aagtggttgaaagaaaatacggaaactgctagttggtaa

DBGET integrated database retrieval system