KEGG   Bacillus cereus NC7401: BCN_0953Help
Entry
BCN_0953          CDS       T01686                                 

Definition
dihydroxyacetone kinase family protein
Orthology
K00863  
dihydroxyacetone kinase [EC:2.7.1.29]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycerolipid metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCN_0953
  Energy metabolism
   00680 Methane metabolism
    BCN_0953
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCN_0953
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.29  glycerone kinase
     BCN_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1026651..1027649)
Genome map
AA seq 332 aa AA seqDB search
MKKIMNDVQNIVQDMMHGFYFEHNDKVNYDETNNIIYVKDIEKTKQGVVIISGGGSGHEP
ADIGYVGKGMLTAAVNGSIFTPPTVEQIVAATRLMPKEKSILFIIKNFKDDVANFLAAEQ
IAKEEGRQIDHIIVNDDVSIEDDASFNKRRRGVAGTVFVQKILGAAALEGHSLEELTALG
RSITENLHTLGVALSPANDPVKGQASFTLNEDEVFYGVGIHGEKGYRKEALSSSEILAIE
LMNKLKSIYRWRKGDNFAILINGLGATPLMEQYIFANDIRRLCELEGLQVTFVKVGTLLT
SLDMKGVSLSLLKIEDLDWVKWLKENTETASW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattatgaatgatgtacaaaatatcgttcaagatatgatgcatggcttttat
tttgaacataacgacaaagtaaattacgacgaaacaaataacatcatttatgtaaaagat
atcgaaaaaacgaagcaaggcgttgtcattataagcggaggtggtagcggacacgagcct
gctgatattggttatgtaggaaaaggaatgcttacggcggccgtaaacggcagcatcttc
actccgcctacagtggaacaaattgtggcggcaactcgcctcatgccaaaagaaaaaagt
atactattcatcataaaaaactttaaagatgacgtagctaactttttagcggcagaacaa
atcgcaaaagaagaaggaagacaaattgaccacatcatcgtaaatgacgacgtttcaatt
gaagatgatgcttcttttaataaaagaagacgcggcgtcgctggtactgttttcgttcaa
aaaatattaggtgcggccgctcttgaaggtcattctttagaagaactgactgcactcggc
cgttctatcactgaaaacttacacacattaggagtcgccctttcacctgccaacgatccg
gtgaaaggacaagcttcattcacattaaacgaagatgaagtcttttacggcgtcggtatt
cacggcgaaaaaggttaccgtaaagaagcactatcctcttctgaaatattagcgattgaa
ctaatgaacaaacttaaaagcatttatcgctggagaaaaggcgacaacttcgccatcctt
attaatggactcggcgcaacacctttaatggaacaatacattttcgcaaatgacattcgt
cgtttgtgtgagctggaaggattacaagttacattcgtaaaggtcggtacactgttaact
tctttagatatgaaaggtgtttcactcagtttgcttaagatagaggatttggattgggtg
aagtggttgaaagaaaatacggaaactgctagttggtaa

DBGET integrated database retrieval system