KEGG   Bacillus cereus NC7401: BCN_1012Help
Entry
BCN_1012          CDS       T01686                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCN_1012
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BCN_1012
Exosome [BR:bnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCN_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079728..1081218
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWDKTTGKPIYNAIVWQSRQTAEICDELKEKGYS
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEVYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKEQWHMDKRFEPTMEAETSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaactagctcacgcgcaattcttttc
aataaaaaaggtgaaattgttcattcagctcaaaaagaatttacacaacattttccaaag
ccaggctgggtagagcataacgcgcaagaaatttggggatctattttagcggttatcgca
acttgtttaagtgaagctgatgtaaagccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacagcggttgtatgggataaaacgactggtaaaccaatttataacgcaatt
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatagc
gaaatggttcgcgaaaaaacaggtcttttaattgacgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggcgatctatta
ttcggaacaattgatacgtggcttgtatggaaactatctggtggtaaagcgcacgtaaca
gactactcaaatgcgtcacgtacattaatgtttaacattcacgacttacagtgggatgat
gagcttctagacatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaagtgtatggagaaacaattgactatcacttcttcggtcaaaatgtaccgattgcaggt
gtagctggtgatcaacaagcggcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacactggtgaaaaagcagtagct
tctgagcacggtctattaacaacaattgcatggggaatagatggtaaagtaaactatgca
ttagaaggaagtattttcgtagcaggttctgcaattcagtggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtgtacgcttctcgcgttgaatcaactgacggt
gtatacgttgtaccagcattcgtaggtttaggtacaccttactgggatagtgaagtacgc
ggcgctatgtttggtgtaacgcgcggtacgacgaaagagcacttcattcgtgcaacacta
gaatctttagcttaccaaacaaaagacgtattatgcgcaatggaagcagattcaggtatt
gaactaaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagacgttcctgtagagcgtccggtaatcaatgaaacaacagcttta
ggtgcagcgtacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gaacagtggcatatggacaaacgttttgaaccaacgatggaagcggaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system