KEGG   Bacillus cereus NC7401: BCN_1104Help
Entry
BCN_1104          CDS       T01686                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bnc  Bacillus cereus NC7401
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCN_1104
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCN_1104
   00630 Glyoxylate and dicarboxylate metabolism
    BCN_1104
Enzymes [BR:bnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCN_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1166937..1168526
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLPGEMLPAYNEILTPEALSFLKELHGNFNERRIELLQKRAEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYHLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESHLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKGFRNHNQFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRLNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacattgcccggagaaatgttgccagcgtacaacgaa
atattgacacctgaggcgcttagttttttgaaggaactacatggaaatttcaatgagcgc
cgcatagaacttttacaaaagcgtgcggagaaacaaaagagaattgatgcaggggagttt
ccgaagtttttagaagaaacgaagcacatacgtgaagctgattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggcccggtagatagaaagatggtt
attaacgctttaaattcaggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcgattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcatttaaatagtaaaacagcagtatta
attgtgcgtccaagaggatggcatttagaagaaaaacatatgcaagttgacggaaagaat
atgtctggtagcttagtagattttggactttattttttccataatgcgaaagctctttta
gcaaaaggaagcggtccatacttttacttaccgaaaatggaaagccatttagaagcaagg
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaacggaacgatc
aaagccacggtgttactggaaacgatacatgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaagggtttccgtaatcataatcaatttttacttccagatagagcgcaagtcacgatg
acggcgccatttatgcgcgcgtattctttgaaagtcattcaaacatgtcaccgtcgtaat
gcaccagctattggaggaatggcagcacaaattccaattaaaaacaatccagaagcaaat
gaagcagcttttgaaaaagttcgtgcggataaggagcgcgaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtaccagtcgcgatggaagtatttaatcacatt
atgaaaacgccgaatcaaatttttagaaaacgtgaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtctgaatattagcgta
ggtattcaatatattgcatcttggttaagcggccgaggagcagcaccaatttataactta
atggaagatgcagcaacagcggaaatttctagggcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagctaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system