KEGG   Bacillus cereus NC7401: BCN_1104Help
Entry
BCN_1104          CDS       T01686                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00620  Pyruvate metabolism
bnc00630  Glyoxylate and dicarboxylate metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01200  Carbon metabolism
Module
bnc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCN_1104
   00630 Glyoxylate and dicarboxylate metabolism
    BCN_1104
Enzymes [BR:bnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCN_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAL16897
Position
1166937..1168526
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLPGEMLPAYNEILTPEALSFLKELHGNFNERRIELLQKRAEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYHLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESHLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKGFRNHNQFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRLNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacattgcccggagaaatgttgccagcgtacaacgaa
atattgacacctgaggcgcttagttttttgaaggaactacatggaaatttcaatgagcgc
cgcatagaacttttacaaaagcgtgcggagaaacaaaagagaattgatgcaggggagttt
ccgaagtttttagaagaaacgaagcacatacgtgaagctgattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggcccggtagatagaaagatggtt
attaacgctttaaattcaggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcgattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcatttaaatagtaaaacagcagtatta
attgtgcgtccaagaggatggcatttagaagaaaaacatatgcaagttgacggaaagaat
atgtctggtagcttagtagattttggactttattttttccataatgcgaaagctctttta
gcaaaaggaagcggtccatacttttacttaccgaaaatggaaagccatttagaagcaagg
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaacggaacgatc
aaagccacggtgttactggaaacgatacatgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaagggtttccgtaatcataatcaatttttacttccagatagagcgcaagtcacgatg
acggcgccatttatgcgcgcgtattctttgaaagtcattcaaacatgtcaccgtcgtaat
gcaccagctattggaggaatggcagcacaaattccaattaaaaacaatccagaagcaaat
gaagcagcttttgaaaaagttcgtgcggataaggagcgcgaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtaccagtcgcgatggaagtatttaatcacatt
atgaaaacgccgaatcaaatttttagaaaacgtgaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtctgaatattagcgta
ggtattcaatatattgcatcttggttaagcggccgaggagcagcaccaatttataactta
atggaagatgcagcaacagcggaaatttctagggcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagctaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system