KEGG   Bacillus cereus NC7401: BCN_1129Help
Entry
BCN_1129          CDS       T01686                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bnc  Bacillus cereus NC7401
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCN_1129
Enzymes [BR:bnc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BCN_1129
Peptidases [BR:bnc01002]
 Cysteine Peptidases
  Family C44
   BCN_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1189606..1191384
Genome map
AA seq 592 aa AA seqDB search
MAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGKQPMTCLKDEANYAICYNGELYNT
EDIRKELLRRGYTFKGHSDTEVLLASYMEWKEECVDHLNGIYAFAVWDEQKEQVFIARDR
LGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLEGLSEIFGLGPSRTPGHGIYAGIK
ELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVEKTRFLLQDAITRQLVSDVPLCTF
LSGGVDSSAITAIAAKEYERSGKGQLHTYSIDYEDNDKYFKANAFQPNSDAPFIHLMTET
FQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADIDSSLLWFCREIKQDFVVGLSGECADE
IFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWRNKLNLQQYVQQRYEESIQEVPIL
EGESPIEAKRRQLFYLNMVWFMTTLLDRKDRMSMGASLEVRVPFADHRLVEYAWNIPWEM
KMYKNREKGLLRKALEGLLPNDILYRKKSPYPKTHNPHYTKAVTVWLQDLLTDKGSILHE
LFDKEQLSGLIESGGSAFQTPWYGQLMTGPQLLAHLAQIHVWFKEYGVNIKE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggctgagacgttagcgaagcgtggcccagatgataataaagtttggattaaaggcaat
gtcgcatttgggcataaacggttaatcgttgttgatcctgaaggtggtaagcagccgatg
acttgcttaaaggacgaagcgaattatgcaatttgctataacggcgaactgtataacacg
gaagatattcgaaaggaactattaagaagaggatatacgttcaaaggtcattctgatacg
gaagtactattagcatcgtatatggaatggaaagaagaatgtgtcgatcatttaaacggt
atatatgcgtttgctgtatgggatgaacagaaagaacaagtgtttattgcacgtgatcga
ttaggtgtaaaaccgctattttataaatatgacagtgggcgattactatttggctcagag
ttaaaagcgatattggcgcatccagatgtgaaggcggaagtgacgttagaaggattatct
gaaatatttggccttggaccatctagaacgcctggtcacggcatttatgctggtataaaa
gaattacgtccaggtcatgcgatgacattttcaaagaacggtttatgcatatggagatat
tggaatgtggaaagtaaaaagcatgaagattcttttgaagagacagtagagaaaacgcgc
tttttattacaagatgcgattacaaggcagctcgtttctgatgtaccactgtgtactttt
ctatcaggtggtgtagactcgagcgcgattacagcaattgctgcgaaagaatacgaaaga
tcaggaaaagggcaattacacacatattcgattgattacgaagataatgacaaatacttt
aaagcaaatgcgtttcagccaaattcagatgcaccatttattcatttgatgactgaaacg
tttcaaacaatccatcatcgctgcgtcatttcaaatgaacaattagcgcagtatttaacc
gaagcagtgctcgttcgcgatttacctggtatggcagatattgattcgtcattattatgg
ttttgtcgagagattaaacaagattttgtcgtcggtctatcgggggaatgtgcagatgaa
atatttggtggttatccgtggttttatagagaggatgatttacaatcgagtgcatttccg
tggatgcgctctacagaagcgcgtgaacaactgctaaaaaaagaatggagaaataaatta
aacttacaacaatatgtacaacagcgctatgaagagtccattcaagaagttcctatttta
gagggagaaagcccaattgaagcaaagagacgacaattattttatttaaatatggtatgg
tttatgacaacattattagacagaaaagaccgtatgagtatgggtgcaagcttagaagta
cgcgttccatttgcggatcaccgacttgtcgaatatgcttggaatattccttgggaaatg
aaaatgtataaaaatcgcgaaaaaggtctattacgtaaagcgttagaaggattacttcca
aatgacatcttatatagaaagaagagcccgtatccgaaaacacataatccgcactatacg
aaagcagtaacagtatggctacaagatttattaacagataaaggatcgattttacacgaa
ctatttgataaagaacagctgagcggattaattgagtcaggcggcagtgcattccaaacg
ccatggtatggtcaattaatgactgggccacaacttttagctcatttagcacaaattcac
gtttggtttaaagaatatggagtaaatattaaagaatag

DBGET integrated database retrieval system