KEGG   Bacillus cereus NC7401: BCN_1217Help
Entry
BCN_1217          CDS       T01686                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01130  Biosynthesis of antibiotics
bnc01230  Biosynthesis of amino acids
Module
bnc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCN_1217
Enzymes [BR:bnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCN_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: BAL17010
Position
1268928..1269689
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVDQKKKEVAALYETYTPVKEKRKTRSLVKALEQFTVIAEVKRASPSKGDINL
HVDVRKQVKAYEECGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEQELEIAIQFNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGVHSKEDMIRVKRAGAKGVLVGEALMTSS
SIHTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagacaaaattgtagatcaaaagaaaaaggaagttgcggcattatat
gaaacatatacaccagtaaaagaaaaaagaaaaacgcgctcacttgtaaaggctctagag
caatttactgtcattgcagaagtaaagcgagcatcaccatcaaaaggagatattaattta
catgttgatgtacgaaaacaagtgaaggcatatgaagaatgcggcgctggtgcagtttct
gttttaacagacggtcaattttttaaaggatcattttatgatttacaaacggcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcgtatgaagctggtgcagatattattttactaatcgtagcggcgttaacgaaagagaaa
ttaaaagagttgtatagctacgtactagaaaaagggttagaagcgattgttgaagttcat
gatgaacaggaattagaaattgcaattcaattcaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaagtcaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcggggttcattcaaaagaagacatgatc
cgcgttaaacgagctggggcaaaaggtgtactagttggagaagcgcttatgacatcgtct
tctattcataccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system