KEGG   Bacillus cereus NC7401: BCN_1219Help
Entry
BCN_1219          CDS       T01686                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCN_1219
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCN_1219
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCN_1219
Enzymes [BR:bnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCN_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1270297..1271490
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEEFQKELNHYLKTYVGRET
PLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcaatggaa
gatgaagagtttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaacg
ccgctttatttcgctgagaatatgacggagtattgcggtggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaataatacaatcggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gttgcaacagctactgtatgtgctctactcggattagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagctgcaggtagcggtacattaaaagatgcggtaaacgaggcacttcgttac
tgggtttcacacgtgcatgatacgcactatattatgggatctgttctcggaccacatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattggaaatgaaacgaaaaaacaatat
gaagcattagaaggaaagttaccagaagcagtcgttgcttgtattggcggtggtagtaat
gcgatgggtatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggagttcatacagaaaagcatgcagctactttaacgaaaggaagcgtt
ggcgttctccacggatcgatgatgtatcttctgcaaaatgaagaaggacaaattcaagaa
gctcactctatttcggcgggacttgattaccctggtgttgggccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaagcgttagaagcattt
caattattaacgaaaaaagaaggaattatcccggcgttagaaagctcgcatgctgtcgcg
tacgctttaaaattagcgccgcaaatgaagaaagacgaagggcttgtcatttgtttatct
ggccgcggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system