KEGG   Bacillus cereus NC7401: BCN_1220Help
Entry
BCN_1220          CDS       T01686                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00260  Glycine, serine and threonine metabolism
bnc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01130  Biosynthesis of antibiotics
bnc01230  Biosynthesis of amino acids
Module
bnc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCN_1220
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCN_1220
Enzymes [BR:bnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCN_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB NMO
Motif
Other DBs
NCBI-ProteinID: BAL17013
Position
1271494..1272270
Genome map
AA seq 258 aa AA seqDB search
MGVEKMKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDGGVTLKGIFQALAEVRKEVQIPFVLMTYLNPVLAFGKEHFIERCLEAGV
DGIIVPDLPYEEQDIIAPLLRTANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHTNLPVVAGFGISTKEHVEEMITICDGVVVGSKIIELLENE
KREEICEFIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaatgaaagcagcatttgaaaatggcaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaaaattaaaagaaagaattcgttttcttgatgaa
gcaggagcaagcatcgttgaaattggtatcccgttttcagatccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatggcggtgtaacattaaagggcattttt
caagcgttagcagaagtaagaaaagaagtacaaattccttttgtactcatgacatactta
aatccagtacttgcattcggaaaagaacacttcattgagagatgcttagaagcaggtgtg
gacggtattatcgttccagacttaccgtatgaagaacaagatattattgcaccgcttctc
cgaactgcaaatatcgctttaatcccactcgttaccgttacgagcccaattgagcgaatc
gagaaaattacgagtgaatcagaagggttcgtctacgctgttacagtagcaggcgtaaca
ggcgtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacat
acaaatttaccggtagtagcagggttcggtatttcaacaaaggaacatgtagaagaaatg
attacaatatgtgacggggttgtcgttggaagtaaaattattgaactgttagaaaatgaa
aaacgagaagaaatatgtgaattcatacaggcaacaaaacaaaaagaagaggcataa

DBGET integrated database retrieval system