KEGG   Bacillus cereus NC7401: BCN_1239Help
Entry
BCN_1239          CDS       T01686                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bnc  Bacillus cereus NC7401
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCN_1239
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCN_1239
  Amino acid metabolism
   00310 Lysine degradation
    BCN_1239
Enzymes [BR:bnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCN_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1289121..1290377)
Genome map
AA seq 418 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAEQPKQETAEAPKAAAPSAEQTATLQGLPNT
NRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPVA
KTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKH
DVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDAN
QLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGM
HKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaacggagca
ccagttgcagtaagtacgcctgcaccggctgagcaaccgaaacaagaaacagctgaagca
ccaaaagctgcggcaccaagtgctgaacaaactgcaactttacaaggtttaccaaataca
aaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgactta
aacgacgtacgtagcacagatccacttggccgtgtgagaccacacgatgtacaagctcat
gctgcagcaccgaaagaagcaccagctgctccaaaaagtccagctcctgctccagttgca
aaaactgaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaatt
gcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaagtt
gatatgactgcaatcatggaattacgtaaagagcgtaaagatgctttcgagaaaaaacat
gatgtacgtcttggtttcatgtcattcttcacaaaagcagttgttgcagcattaaaacaa
ttcccattattaaatgctgaaattcaaggcgacgagcttatcattaaaaaattctatgat
atcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgcgaac
caattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgat
aacaaactttcactaaaagaactacaaggtggtacatttacaattacaaacggtggtgtg
ttcggttctctaatgtcaacaccgatcctaaacagcccacaagttggtattttaggaatg
cataaaatccaagtacgtccagttgcaatcgataacgaacgtatggaaaaccgcccaatg
atgtacatcgctttatcttacgatcaccgtattgttgatggcaaagaagcagttagcttc
cttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system