KEGG   Bacillus cereus NC7401: BCN_1384Help
Entry
BCN_1384          CDS       T01686                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bnc  Bacillus cereus NC7401
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCN_1384
  Amino acid metabolism
   00340 Histidine metabolism
    BCN_1384
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BCN_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1414722..1416011
Genome map
AA seq 429 aa AA seqDB search
MEIVFEDFQKALSKIKLLRENANIIEETVQRNVSEIVQNVRESRDEALSFYTKKFDGVKM
KEFRVSEEEIKRASMFVENSFLEALQEAKKNIISYHEKQKRQSMFDCASKGIIRGQIIRP
LENVGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPREGGIDPHILVAASLAGVDE
IYTIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIELAKEVEKEIERQLETLPRSEIARESIK
RNGAIFIVPSLDEALNLSNEVAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEEALRDVKHHIVELASKEGLHAHARA
IQIRFEEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgtttttgaagattttcaaaaggcgttatcgaaaataaaattgctacgagaa
aacgctaatataatagaagaaactgttcaaagaaatgtaagtgaaatcgttcaaaatgta
agggagagtagagatgaggccttatctttttatacaaaaaagtttgatggtgtaaagatg
aaagagtttcgtgtaagtgaagaagaaataaaacgagcgagtatgtttgtagagaattca
tttttagaagcgttacaagaggcgaagaaaaacattatttcgtaccatgaaaagcaaaaa
agacaatcgatgttcgattgcgcgagtaaaggcatcattagaggacaaatcattcggcca
ttagagaatgtaggcgtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaaactcgctggtgtgaaaaagattgtaatggtaacaccgcca
agagaaggaggaattgatccacatattttagttgctgcaagtcttgcaggagtagatgaa
atttatacgataggtggtgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccgaaagtggataaaatagttggaccaggaaatttgtacgtcgctctagcgaaacgagaa
gtatatggaatagtaaatattgatatgattgctggaccgtcagaaattgtagttattgca
gatgaaaccggcaatgcaaaatatattgctgctgatttattatcacaagcagaacatgac
gagagagcgacagcaatttgtattacaacaaatatagagttagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagcgaaattgcacgtgaatcaataaag
agaaatggggccatttttatcgttccttctttagatgaggcgctaaatttatcgaatgaa
gttgccccggaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccatatgcaccagaaccgctcggggattattta
gcaggaccgaatcacgtgttaccgacaagtggaacggcaaggtttttctcaccgttatca
gtcgatgattttgtgaaaaaatcaagctttctgtcttatacagaggaagcattaagagat
gtaaaacatcatattgtagagcttgccagtaaagaagggttacatgcgcatgcgagagca
attcaaataagatttgaggaggaagaataa

DBGET integrated database retrieval system