KEGG   Bacillus cereus NC7401: BCN_1689Help
Entry
BCN_1689          CDS       T01686                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCN_1689
   01230 Biosynthesis of amino acids
    BCN_1689
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCN_1689
  Energy metabolism
   00680 Methane metabolism
    BCN_1689
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCN_1689
Enzymes [BR:bnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCN_1689
Exosome [BR:bnc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCN_1689
  Exosomal proteins of melanoma cells
   BCN_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1692821..1693390
Genome map
AA seq 189 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHLDAENVTRLLKDKHIDVVISSPYKRAIQTVQG
IANTYHVSIEIEENLRERLLSKEPVTDFNNAVQKVWEDWDFAYEGGESNEVAQRRAVICM
QNILKKYEDQNIVIGTHGNIMVLLMNYFDSKYDFRFWKTLRMPDIFKLNFHNEDLISAER
IENTGHQIK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagaacgggag
cgacctttatctgaaaaagggcacttagatgcagagaatgtaacacgcttattaaaagat
aaacatattgatgttgtgatttctagcccctacaaaagagcaattcaaactgtacaagga
attgcgaatacatatcatgtatcaatagaaatagaagaaaatttacgggaaagattatta
agtaaagagccagtaacagattttaataatgcggtccaaaaggtgtgggaagattgggat
tttgcatacgagggcggagaatcgaatgaagtagcgcaaaggcgtgctgtaatatgtatg
caaaatatattaaaaaaatatgaagatcagaatattgtaataggaactcatggaaatatt
atggtattactcatgaattattttgattcaaaatatgattttcgattttggaaaacactt
cgtatgcccgatatatttaagttgaattttcataatgaagatttaatttctgccgaaagg
atagagaatacgggtcatcaaataaagtga

DBGET integrated database retrieval system