KEGG   Bacillus cereus NC7401: BCN_1695Help
Entry
BCN_1695          CDS       T01686                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bnc  Bacillus cereus NC7401
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bnc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1696642..1698324)
Genome map
AA seq 560 aa AA seqDB search
MEITSKPYLSSWTQPKTFRAGDYTYALTYNGEIYNFRELREQLRKCGHTFETHSDTEVLL
HAYLEWKEDCVQHLNGIFAFALWDDQKQQLFLARDHLGVKPLFYTERNDSIIFGSEIKAL
LAHPSVPAEIDTDGINEIFGLGLFRTPGCGVFKHIQEVRAGHSITFTRDKKVVTKYWNLE
SKVHTDSIEDTSSHILSILQDTVKRQLIADVPLVCMLSGGLDSSGITALAGKEFAAENKT
LHTYSVDFVNSAKDFELTFARTGLDAPWVKRVSEHVGTSHHDIIVNAEELANHLFVPLRA
KDLPSAGEMETSLYLLFCEMKKDATVALSGESADEVFGGYPWFHQEELLYVDKFPWLTNW
KNTSPLLLHEISNQCNLENYIDTRFQEAILEVPTLEGESKKSAKQRQMFYLFLTRFLPFL
LDRKDRMSMAVGFEVRVPFCDYRLVEYLWNVPFNIKSIDNIEKGILRRALKPALPDDVRN
RRKSAYPTSQDPHYLKTIRHLSLDMCSNKNNPIFSLINHSTLLAIADGSNKEINNFEARS
AMEYMLQVNEWLKTYHIHIA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtggagattacatcaaagccttacctatcatcatggacacagccgaagacatttcgtgct
ggtgattatacgtatgctcttacttataatggagaaatttataatttccgtgagctgaga
gaacaacttaggaaatgtggtcatacatttgaaacgcattcagatacagaagtgttacta
catgcttatttagaatggaaagaagactgcgtacaacatttaaacggcattttcgctttc
gccttatgggatgatcagaagcaacaactgtttttagcacgtgatcatttaggcgtaaaa
ccactcttttatacagaaagaaatgacagtattattttcggatctgaaattaaagcatta
ttagctcatccatctgtccctgctgaaattgatacggatggcataaatgaaatatttgga
ttagggttatttcgaactccaggatgtggcgtctttaaacatattcaagaagtgcgtgct
ggacattctataacgtttacacgtgataaaaaagtagttacgaagtattggaatttagaa
agtaaggtccatacagattctatagaagatacatcatcacatattttatctattttacaa
gatacagtaaaaagacaattaattgccgatgtccctctcgtctgcatgttatcaggagga
ttagattctagcggtattactgcactagcaggaaaagaatttgctgctgaaaataaaaca
cttcatacgtattccgttgactttgtaaatagcgcaaaagatttcgagctgacatttgct
cgcactggtttagacgctccttgggtaaaacgcgtttctgaacatgtagggacatctcat
catgatattattgtgaatgctgaagaattagctaatcacttattcgttcccctccgtgca
aaagatttaccgagtgctggcgaaatggaaacttcactatatttactattttgcgaaatg
aaaaaagatgcgaccgtagctttatccggcgaatctgctgatgaagtattcggtggatac
ccttggtttcatcaagaagaattactatatgtcgataagtttccttggctaacaaattgg
aagaatacatctcctcttctactacatgaaataagtaaccaatgtaatctagaaaactat
attgatacacgattccaagaagcgatacttgaagtacctactcttgaaggtgaaagtaaa
aaatccgcgaaacaacgtcaaatgttttatttatttttaacgagatttcttccgttctta
cttgaccgtaaagaccgtatgagtatggctgtaggatttgaagttcgtgtaccgttttgc
gattatagattagttgaatatttatggaacgttcctttcaacataaaaagcattgataat
attgaaaaaggcattttacgtagagcactgaaacctgctttacctgacgatgtacgcaat
agaagaaaaagtgcttatccaacttcacaagacccacattatttaaaaacaattcgtcat
ttatcactcgacatgtgcagtaataaaaacaatcctattttctcacttattaatcattcc
acattacttgctattgccgatggaagtaataaagaaattaacaatttcgaagcaagaagt
gctatggaatacatgctacaagtaaacgaatggttaaaaacatatcatattcatattgct
taa

DBGET integrated database retrieval system