KEGG   Bacillus cereus NC7401: BCN_1805Help
Entry
BCN_1805          CDS       T01686                                 

Definition
2-dehydropantoate 2-reductase
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bnc  Bacillus cereus NC7401
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:bnc00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1812905..1813849
Genome map
AA seq 314 aa AA seqDB search
MRILVLGAGGVGGFFGGRLVEKGEDVTFLVRSKRKKQLEERGLVIRSVNGDFSFQPKLIT
KEDQTAPFDVILFSTKAYHLNEAIQDLKPFVGESTVIIPLLNGIAHVSLLQKEFGEEKVI
GGLCFIETTLNDQGEIVQTSAANRLMFGEMKSQNSERIKHISKAFAGTKSSFILSENIMQ
DMWHKYLFITVMSGVTTLMRAPIGPIRESEGGRDFIRNVFEESVQIMRVLGAPVKENIAE
EHMKTIDKISYDMKSSMQRDMEKGSFIEGKHLQGYLLDVAEQFSIAAPLLGTIYQNLKVY
EEMTFNRSVIELDV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttagtattaggagcgggaggcgttggaggcttttttgggggacgcttagta
gaaaaaggagaagatgttacttttcttgttcgtagtaaacggaaaaaacaattggaggaa
agaggacttgtaatccgcagtgttaatggggatttttccttccaaccgaaattaataacg
aaagaagatcaaactgctccatttgatgtgattctattttcaacaaaagcgtatcactta
aatgaggcaattcaagatttgaagccgtttgtaggtgaaagtactgtaatcattccgttg
ctaaatggtattgctcatgtatcgctattacaaaaggaattcggtgaggaaaaagtaatt
ggtggtttatgctttatcgagacgacgttaaacgatcaaggagaaattgtacaaactagc
gctgcaaatagacttatgtttggagaaatgaagtctcaaaattcagagagaataaagcat
atttctaaagcatttgcaggtacgaaatctagttttattttaagtgaaaacattatgcaa
gatatgtggcataaatatttatttattactgtaatgtccggtgtgacaacgttaatgcgt
gcaccaattggaccaatccgtgaaagtgaaggcggccgtgattttatccgtaatgtgttt
gaggaatctgtacaaatcatgagagtattaggagcccccgtaaaggaaaatattgccgag
gaacatatgaaaacgattgataaaatttcgtatgatatgaagtcatcaatgcaacgtgat
atggaaaagggttcgtttattgaagggaagcacttgcaaggatatttactggatgtagca
gagcaattttcaatagcggcaccattattaggcactatatatcaaaatttaaaggtgtat
gaagagatgacctttaacagatctgtaatagaattagatgtatga

DBGET integrated database retrieval system