KEGG   Bacillus cereus NC7401: BCN_1805Help
Entry
BCN_1805          CDS       T01686                                 

Definition
(GenBank) 2-dehydropantoate 2-reductase, putative
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00770  Pantothenate and CoA biosynthesis
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
Module
bnc_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BCN_1805
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     BCN_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA ApbA_C F420_oxidored NAD_Gly3P_dh_N Herpes_UL43 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAL17598
Position
1812905..1813849
Genome map
AA seq 314 aa AA seqDB search
MRILVLGAGGVGGFFGGRLVEKGEDVTFLVRSKRKKQLEERGLVIRSVNGDFSFQPKLIT
KEDQTAPFDVILFSTKAYHLNEAIQDLKPFVGESTVIIPLLNGIAHVSLLQKEFGEEKVI
GGLCFIETTLNDQGEIVQTSAANRLMFGEMKSQNSERIKHISKAFAGTKSSFILSENIMQ
DMWHKYLFITVMSGVTTLMRAPIGPIRESEGGRDFIRNVFEESVQIMRVLGAPVKENIAE
EHMKTIDKISYDMKSSMQRDMEKGSFIEGKHLQGYLLDVAEQFSIAAPLLGTIYQNLKVY
EEMTFNRSVIELDV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttagtattaggagcgggaggcgttggaggcttttttgggggacgcttagta
gaaaaaggagaagatgttacttttcttgttcgtagtaaacggaaaaaacaattggaggaa
agaggacttgtaatccgcagtgttaatggggatttttccttccaaccgaaattaataacg
aaagaagatcaaactgctccatttgatgtgattctattttcaacaaaagcgtatcactta
aatgaggcaattcaagatttgaagccgtttgtaggtgaaagtactgtaatcattccgttg
ctaaatggtattgctcatgtatcgctattacaaaaggaattcggtgaggaaaaagtaatt
ggtggtttatgctttatcgagacgacgttaaacgatcaaggagaaattgtacaaactagc
gctgcaaatagacttatgtttggagaaatgaagtctcaaaattcagagagaataaagcat
atttctaaagcatttgcaggtacgaaatctagttttattttaagtgaaaacattatgcaa
gatatgtggcataaatatttatttattactgtaatgtccggtgtgacaacgttaatgcgt
gcaccaattggaccaatccgtgaaagtgaaggcggccgtgattttatccgtaatgtgttt
gaggaatctgtacaaatcatgagagtattaggagcccccgtaaaggaaaatattgccgag
gaacatatgaaaacgattgataaaatttcgtatgatatgaagtcatcaatgcaacgtgat
atggaaaagggttcgtttattgaagggaagcacttgcaaggatatttactggatgtagca
gagcaattttcaatagcggcaccattattaggcactatatatcaaaatttaaaggtgtat
gaagagatgacctttaacagatctgtaatagaattagatgtatga

DBGET integrated database retrieval system