KEGG   Bacillus cereus NC7401: BCN_1888Help
Entry
BCN_1888          CDS       T01686                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCN_1888
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCN_1888
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCN_1888
Enzymes [BR:bnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCN_1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1893902..1894960
Genome map
AA seq 352 aa AA seqDB search
MYKGLLNEYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaacgaatatgcttcttatttaccggtaaatgaaaacacacct
gatgtgagcttaatggaaggaaatacaccccttattccgttattaaatatatcaaaacaa
ttagggattcagttatatggtaagtacgaaggagcgaatccgacaggttcctttaaagat
cgtggtatggtaatggcagtcgcaaaggcaaaagaagaaggttcggaggccattatttgc
gcatcgacaggcaatacatcagcatcggctgccgcatacgcggcacgccttggaatgaaa
tgtattatcgtaataccggaaggaaagattgcacatgggaaattagcgcaagcagttgcc
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcactaaaggctgtaaga
aatattgctgcagaagagccgattacgttagtaaactctgtaaatccttatcgaattgaa
gggcaaaaaacagcagcatttgaaatttgtgaccagttgcaacgtgcaccagatgtatta
gcgatccctgttgggaatgccgggaatattacagcatactggaaagggttctgtgaatat
gagaaagaaaaaggctataagaagccaagaattcatggatttgaagcggaaggagcagct
gctattgtaaaaggacacgtcattgaagaacctgaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcagtagaggctgctgagcaatctcacggcgaaata
gatatggtatcagatgaagagattttacatgcatatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagttgttgcagttttaactggaaacggcttgaaagat
cctgatatcgcaatctcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system