KEGG   Bacillus cereus NC7401: BCN_1920Help
Entry
BCN_1920          CDS       T01686                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCN_1920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCN_1920
   00052 Galactose metabolism
    BCN_1920
   00500 Starch and sucrose metabolism
    BCN_1920
   00520 Amino sugar and nucleotide sugar metabolism
    BCN_1920
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCN_1920
   00524 Butirosin and neomycin biosynthesis
    BCN_1920
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCN_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1926176..1927072
Genome map
AA seq 298 aa AA seqDB search
MKKAVGIDIGGTKIAAGVISETGELLERAEIKSDPSDREKMFGKVVEAMEQVLRKSSISI
ADIEGIGVGVPGKVDFEKGIAVFQNNLPWRQFPISVRLQEQFGIQRIKIDNDVYMAAYAE
WRATHVKEDKTFVYVTISTGISCSIIHRGSFFRGAGFAGELGLIPVLTRGGNERLEKIAA
GPGIQRIAERDLQVGTISTKDVFASYINGVPEYQSIINEVTDYLAQGLYKISCLLDPHRM
VFGGSVIVKNPFLLELIKVKLKSFQLPEQQHLLEQMSISTLAQNNGVVGAGLRVFEGM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcagtcggcattgatattgggggaacgaagattgcggcgggagtcatttcg
gagacgggcgagctgcttgaacgtgcggaaataaaaagcgatccttcagatcgagaaaaa
atgtttggtaaagttgtagaagctatggagcaagttctcagaaaatcatcgatttccatc
gctgatatcgagggtattggagttggggtaccgggaaaagtagatttcgagaagggaatt
gccgtttttcaaaacaatttaccttggaggcagtttcctatttcggtccgtttgcaagag
caatttggtattcagcggattaagattgacaatgatgtctatatggcggcttatgctgaa
tggagagcaacacatgtaaaagaggataaaacctttgtctacgtgactataagtacggga
atatcttgttctatcattcatagaggctcattttttaggggggcaggatttgctggagaa
ctgggtttgattcctgtcctcacgagagggggcaatgaacgattagaaaaaattgctgct
gggccagggatccagagaatagccgaaagagatttacaggtaggtacgatttcaacaaaa
gatgtttttgctagttatataaatggggtaccagaatatcagtccattatcaatgaggta
actgattatttagctcaaggtctttataagatttcctgtttattagatccacatagaatg
gtttttggtggcagtgtcattgtgaaaaatccatttctactggagttgatcaaagtgaag
ctaaagagttttcagcttcctgagcaacaacatcttttggagcagatgagcatcagtaca
ttggcacaaaataatggagttgttggtgcgggattacgagtatttgaaggtatgtaa

DBGET integrated database retrieval system