KEGG   Bacillus cereus NC7401: BCN_2082Help
Entry
BCN_2082          CDS       T01686                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00480  Glutathione metabolism
bnc00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BCN_2082
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCN_2082
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BCN_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAL17875
Position
2067021..2067503
Genome map
AA seq 160 aa AA seqDB search
MTIYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttatgatttttcagctaaaacaattacaggtgaagaaaaatcgttaaaagat
tacgaaggaaaagcacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagcagatattacaagtttt
tgtgaattaaactacggcgtaaacttcccaatgtttgcaaagattgatgtaaaaggtgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtgaaatggaactttactaagtttttaattggaaaagacgggaaagtagtagggcgt
tttgctccgcagacgaagccggtggatttagaggttgagattgagaaggtacttggcgaa
taa

DBGET integrated database retrieval system