KEGG   Bacillus cereus NC7401: BCN_2164Help
Entry
BCN_2164          CDS       T01686                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bnc  Bacillus cereus NC7401
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCN_2164
   00670 One carbon pool by folate
    BCN_2164
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BCN_2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2151183..2151671
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttcatttatggtcgcaatggacgagaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattacaatatgtaaagaaaacaacgatgggtcatccg
cttattatgggaagaaagaactatgaagcgattggtagaccactgcctggaagacgtaat
attattgtaactcgcaatgaagggtatcatgttgaaggatgtgaagtagcacattctgta
gaagaagtgtttgagctatgcaaaaatgaagaagagatctttatttttggcggagcacaa
atttatgatctctttttaccttacgtagacaagttatatataacaaaaatccatcatgca
tttgaaggagatacattcttcccagaaatggatatgacaaattggaaagaagtttttgtt
gaaaaaggtttaacggatgaaaaaaatccgtatacgtactattatcatgtatatgagaag
caacaatag

DBGET integrated database retrieval system