KEGG   Bacillus cereus NC7401: BCN_2196Help
Entry
BCN_2196          CDS       T01686                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00010  Glycolysis / Gluconeogenesis
bnc00071  Fatty acid degradation
bnc00350  Tyrosine metabolism
bnc00625  Chloroalkane and chloroalkene degradation
bnc00626  Naphthalene degradation
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01130  Biosynthesis of antibiotics
bnc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCN_2196
  Lipid metabolism
   00071 Fatty acid degradation
    BCN_2196
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCN_2196
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCN_2196
   00626 Naphthalene degradation
    BCN_2196
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCN_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C TrkA_N Methyltransf_31 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: BAL17989
Position
2176277..2177314
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGIGIVTKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSNIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQDEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKQHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagcaaacattgaagttattgaaaaggaa
ttacgtccgttacactcaggtgaagcactagtagatgtagagtattgtggggtttgtcat
actgatttacacgttgcgaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtataggtattgtgacgaagattgctgatgatgttacgtcactaaaggtgggagac
cgtgtaagtattgcatggatgttccaatcttgtgggcgttgcgaatattgcgtaacaggt
agggaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgtgacagctgattatgcggtgaaagtaccagaaggattagatccagct
caagcatcatcaatcacatgtgcgggtgtaactacatataaagctataaaagtatcaaat
attaaacctggccaacctatcgtcatctatggttgtggtggattaggtaacctagctatt
caatatgctaaaaacgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ttagccttagcaaaagaggttggagctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattgttcaagatgagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaagtagcattcaactctgcagttgatgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaacgatggatttaaatattccgcgacttgtactagatggaatt
gaagtggttggctctctagtcggtactcgtaaggatctagaagaggcatttatgttcggt
gcagaaggaaaagtagtgcctgttgttcaaacttgttctctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtcgaattcaaggacgtatggtaatcgattttaaacagcat
aattgtgattgcaaataa

DBGET integrated database retrieval system