KEGG   Bacillus cereus NC7401: BCN_2225Help
Entry
BCN_2225          CDS       T01686                                 

Definition
M20/M25/M40 family peptidase
Orthology
K01438  
acetylornithine deacetylase [EC:3.5.1.16]
Organism
bnc  Bacillus cereus NC7401
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BCN_2225
   01230 Biosynthesis of amino acids
    BCN_2225
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCN_2225
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BCN_2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2208038..2209306
Genome map
AA seq 422 aa AA seqDB search
MEQLKKQVCDYIESHEEESVKFLKRLIQEKSVSGDESGAQAIVIEKLRELGLDLDIWEPS
FSKMKDHPYFVSPRTSFADSPNIVATLKGSGDGKSMILNGHIDVVPEGDVNQWDYHPYSG
EKIGNRIYGRGTTDMKGGNVALMLAMEAIIESRIELKGDIYFQSVIEEESGGAGTLATIL
RGYKADGVIIPEPTNMKFFPKQQGSMWFRLHVKGKAAHGGTRYEGVSAIEKSMFVIDHLR
KLEEKRNDRITDPLFKGIPIPIPINIGKIEGGSWPSSVPDSLILEGRCGIAPNETIEAAK
EEFENWIAELNDVDNWFVENPVEVEWFGARWVPGELEENHELITTLEHNFVEIEGNKPII
EASPWGTDGGLFTQIAGVPTIVFGPGETKVAHYPNEYIEVDKMIAAAKIIACTLLDWCEV
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggagcaattaaaaaaacaagtttgtgattatattgagagtcatgaagaagaaagcgta
aaatttttaaaacgattaattcaagaaaagagcgtatctggtgatgaaagtggtgcgcag
gcaattgtaattgaaaaattacgtgagctaggtttagatcttgatatatgggagccttca
ttttcaaaaatgaaagatcatccttattttgtatcaccgcgtacaagttttgcagatagc
ccgaacattgtggcaactcttaaaggaagcggcgacgggaaatctatgatattaaatggg
catattgatgtcgtaccagaaggagatgtgaatcagtgggactatcatccttatagtggt
gagaaaataggaaatcgtatatatggtcgtggaacgacagatatgaagggcggaaatgtc
gcattaatgcttgcgatggaagcaattattgaatctcgtattgaattaaaaggagatatt
tattttcaaagtgtaatagaagaagaaagcggcggagcaggaacattagcaactatatta
cgaggatataaagcagatggtgttattattccggagccaacaaatatgaagtttttcccg
aaacaacaaggatccatgtggtttcgtctacatgtgaaagggaaagcagcacacggtggg
acgcgttatgaaggagtaagtgcaattgaaaaaagtatgtttgttatagatcatttgaga
aagttagaagagaagagaaatgaccgaattacagatccattatttaaaggaatcccgatc
ccaattccaattaatattgggaaaattgaaggcggtagttggccaagttctgttcctgat
tcgttaattttagaaggaagatgcggtattgcgccgaatgagactatagaggcagcaaaa
gaagagttcgagaattggatcgctgaattaaatgatgtggacaattggtttgttgaaaat
cctgtagaagtggaatggtttggagcaagatgggttccaggtgaactagaagaaaatcat
gagttaattacaacgcttgaacataactttgttgaaatcgaagggaacaaaccgattatt
gaagcatcaccgtgggggactgatggaggtttatttacacaaatcgcaggtgtaccaacg
atagtatttggcccaggagaaacgaaagtagcgcattatccaaacgaatatatagaagtt
gataaaatgatagctgccgcaaaaattattgcatgtacattactagattggtgtgaggtg
aaaaaatga

DBGET integrated database retrieval system