KEGG   Bacillus cereus NC7401: BCN_2225Help
Entry
BCN_2225          CDS       T01686                                 

Definition
(GenBank) peptidase, M20/M25/M40 family
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00220  Arginine biosynthesis
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01130  Biosynthesis of antibiotics
bnc01210  2-Oxocarboxylic acid metabolism
bnc01230  Biosynthesis of amino acids
Module
bnc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BCN_2225
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BCN_2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAL18018
Position
2208038..2209306
Genome map
AA seq 422 aa AA seqDB search
MEQLKKQVCDYIESHEEESVKFLKRLIQEKSVSGDESGAQAIVIEKLRELGLDLDIWEPS
FSKMKDHPYFVSPRTSFADSPNIVATLKGSGDGKSMILNGHIDVVPEGDVNQWDYHPYSG
EKIGNRIYGRGTTDMKGGNVALMLAMEAIIESRIELKGDIYFQSVIEEESGGAGTLATIL
RGYKADGVIIPEPTNMKFFPKQQGSMWFRLHVKGKAAHGGTRYEGVSAIEKSMFVIDHLR
KLEEKRNDRITDPLFKGIPIPIPINIGKIEGGSWPSSVPDSLILEGRCGIAPNETIEAAK
EEFENWIAELNDVDNWFVENPVEVEWFGARWVPGELEENHELITTLEHNFVEIEGNKPII
EASPWGTDGGLFTQIAGVPTIVFGPGETKVAHYPNEYIEVDKMIAAAKIIACTLLDWCEV
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggagcaattaaaaaaacaagtttgtgattatattgagagtcatgaagaagaaagcgta
aaatttttaaaacgattaattcaagaaaagagcgtatctggtgatgaaagtggtgcgcag
gcaattgtaattgaaaaattacgtgagctaggtttagatcttgatatatgggagccttca
ttttcaaaaatgaaagatcatccttattttgtatcaccgcgtacaagttttgcagatagc
ccgaacattgtggcaactcttaaaggaagcggcgacgggaaatctatgatattaaatggg
catattgatgtcgtaccagaaggagatgtgaatcagtgggactatcatccttatagtggt
gagaaaataggaaatcgtatatatggtcgtggaacgacagatatgaagggcggaaatgtc
gcattaatgcttgcgatggaagcaattattgaatctcgtattgaattaaaaggagatatt
tattttcaaagtgtaatagaagaagaaagcggcggagcaggaacattagcaactatatta
cgaggatataaagcagatggtgttattattccggagccaacaaatatgaagtttttcccg
aaacaacaaggatccatgtggtttcgtctacatgtgaaagggaaagcagcacacggtggg
acgcgttatgaaggagtaagtgcaattgaaaaaagtatgtttgttatagatcatttgaga
aagttagaagagaagagaaatgaccgaattacagatccattatttaaaggaatcccgatc
ccaattccaattaatattgggaaaattgaaggcggtagttggccaagttctgttcctgat
tcgttaattttagaaggaagatgcggtattgcgccgaatgagactatagaggcagcaaaa
gaagagttcgagaattggatcgctgaattaaatgatgtggacaattggtttgttgaaaat
cctgtagaagtggaatggtttggagcaagatgggttccaggtgaactagaagaaaatcat
gagttaattacaacgcttgaacataactttgttgaaatcgaagggaacaaaccgattatt
gaagcatcaccgtgggggactgatggaggtttatttacacaaatcgcaggtgtaccaacg
atagtatttggcccaggagaaacgaaagtagcgcattatccaaacgaatatatagaagtt
gataaaatgatagctgccgcaaaaattattgcatgtacattactagattggtgtgaggtg
aaaaaatga

DBGET integrated database retrieval system