KEGG   Bacillus cereus NC7401: BCN_2338Help
Entry
BCN_2338          CDS       T01686                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bnc  Bacillus cereus NC7401
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCN_2338
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BCN_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2311424..2312824
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLIKDLNLEEEMVYNETGISYIYSDNILHPIPSDTIFGIPMSARSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLAVFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEVLTETV
VKKGVVTTAVSKQGNRYEVSFANHESIQADYVVLATPHDIAESLLQSNELNEQFHTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGNQKLLVRMFYKS
TNPVYETIKNYNEEKLVRVALYDIEKSLGIKGEPEVVEVTKWKDLMPKYHLEHNQAVQTL
QEKMTDLYPNVYLAGASYYGVGIGACIGNGKNTANKIIATLNEPTN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgtcatcggtggaggtataacgggactttctactatgttttattta
gaaaaattaaaaaaggattataatatagatttaaatttaatccttgtagaaaaagaagag
tacttaggtgggaaaatccatagtgtagaagaaaaggattttattatggaatccggagca
gattctatcgttgctcgtaatgaacatgtcatgccgcttataaaagatttaaatttagaa
gaagaaatggtatataatgaaacgggtatttcttacatatattcggataatattttacat
ccaattccttctgatactatatttgggataccgatgagtgcccgatcgttgtttagcagt
acgctagtatcaacgaaagggaaaattgttgctttaaaagatttcataacgaaaaataaa
gagtttacaaaagatacttctcttgctgtatttttagaaagctttttaggaaaagagtta
gtagaaagacaaattgctccggtgctttcaggtgtatattctggtaaattgaatgagctt
actatggcgtctacactaccgtatttactggattataaaaataaatatggaagtattatt
aaaggttttgaagagaataaaaagcagtttcaatcagcaggaaacaaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaagtgctgactgagacggtt
gttaagaagggtgttgtaacgacagctgtaagtaaacaaggtaatcgctatgaagtctcc
tttgcaaatcacgaatcaatccaagctgattatgttgttttagcaactccgcatgatatc
gcagaaagtttattacagtctaatgagttaaacgagcagtttcatacatttaaaaattca
tcacttataagtatttacttaggatttgacatactagatgaacaattaccagcggacggc
acaggatttatcgtaacagaaaacagtgatttacattgtgatgcttgtacatggacaagc
cggaagtggaaacatacatctggaaaccaaaagctattagtgagaatgttttataagagt
acgaatccggtatatgaaacgattaaaaattataatgaagaaaaactagtacgagtcgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aaatggaaagatttaatgccgaaatatcatttagaacataatcaagcagttcaaacatta
caagaaaaaatgacggatctatatcctaatgtatacttagcaggtgcctcatattacggt
gtcggtattggtgcgtgtattggaaatggaaagaacactgcaaataagataattgcaaca
ttaaatgaaccgacaaattaa

DBGET integrated database retrieval system