KEGG   Bacillus cereus NC7401: BCN_2400Help
Entry
BCN_2400          CDS       T01686                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bnc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bnc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bnc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bnc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bnc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2371569..2372306
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSEKGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWVPVHKCWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKALKKGEFPLTECLVDTEKRVLAYWHSEIAPKLKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHITF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaaaggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaacggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggatcttgcctgggtgccagtacat
aaatgttggaagctaaatgaaagacattatggtgcattgcaagggttgaataaagatgaa
accgcgcaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaggatgatcccaggtatgaaatgaatgatccaagatataaagca
ctgaaaaaaggtgagtttccattgacagaatgtttagtggatacggagaaaagagtactt
gcttattggcattcagaaattgcgccgaaattaaagaatggtaacaaagtaatcatttca
tcacatggtaacacaattcgctcgctagtaaaatatttagataatctttcaagcgatggt
gtcgtttcattaaatattccaacgagcataccactcgtgtatgaattagacgaaaattta
cgtccgattcgccattattacttaagtatggatggagaagtacctgaaggagaaattccg
aaacatattactttttaa

DBGET integrated database retrieval system