KEGG   Bacillus cereus NC7401: BCN_2426Help
Entry
BCN_2426          CDS       T01686                                 

Definition
acetoacetyl-CoA synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bnc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bnc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bnc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bnc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bnc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2395599..2397539
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TEVLDLQNGTPFAQWYNGGTCNVVESVLSRWLADDETRTQPALQYEGENGTSKSFTYEEL
DSWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKVVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFVHAEEMHSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKSNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGNPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVVYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDDVKGEVCHCFVVLRDNVTFSGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtataaagaaaaaacacgcttatatggt
tggatgaaatcattggggtatgaagactatgaaacgttttataataaatctattgaagaa
acagcttggttttggggagaagctgagaaagcggttggctatcaatggatgaaaccttat
acagaagtgttagacctgcaaaatggtacgccgtttgcacagtggtataatggcggaaca
tgtaatgttgtagaatcggttttatcacgctggcttgcagacgatgaaacaagaacacaa
ccagcacttcagtatgaaggggaaaatggaacttcaaaatcatttacatatgaagagctt
gatagctgggtaagtcgcgttgcaaacggtttgaaacatgcaggtattgaaaaaggtgac
cgtgtcacaatttatatgccgatgattccagaaacagttgttgcgatgctagcggttatg
aagatcggagcaattatttcaccaatattctcaggatttgcgtctgatgcagtcatgaca
cgtgtgcaagcggcaggatctaaaatgattattactgcagatggtttttcacgccgaggt
aaagttgtttcattaaaagacgaagtagataaggcttgtgagcattgtccaactgttgaa
aaagttgttatcgtgcgtcatgcaggaaatgattttacaccgcataattatgatttctca
tggagtacgttagaaaaagaaaagccatttgtacatgctgaagaaatgcatagtgatgat
ccattaatgctcatttatacatcaggtacaactggaaaaccgaaagggacagtacatact
catgctggatttcccttaaaggcagcttttgatgcggggttcggaatgaatattaaacaa
ggtgaccgcgtattatgggtaactgatatgggatggatgatgggaccatttttactattc
ggttctcttattaatggggcaacaatggttatgtacgaaggcgttccggatttcccagaa
gcagatcgtttatgggagacagttgataaatatgaaattacacatctcggtatatcacca
acattaattcgtgcgttaatggcaaaaggtgatgagtatgtaaataaacattcgcttaag
agtttagaagtattcgcctcaacaggcgagccttggaatccagatccttggatgtggcta
tttgaaacggttggaaaaagtaatgtaccaatttgtaactattcaggcgggactgaaatt
tctggtggaattttcggaaacgtccttattaaaccaattgcaccgattagctttaacgct
tctttaccaggaatggcagcggttgtgctcgatgatcagggcaatccgattcgtgatgaa
gttggagaattatgtttagagaaaccttgggttggtatgacgaaaagtttctgggaagat
gatgagcgttatgtgaacacatattggtcacgttttgaaaataaatgggttcatggtgac
tgggtggtttatgatggtgaacaatatattattacaggacgctcagatgatacgctaaac
attgctggaaaacgcattggacctgctgaatatgaatctattcttgtgaagcataatgat
gtcatagaagctgctgcgattggtgtaccagatgatgtaaaaggtgaagtttgtcattgt
tttgtagtattaagagacaatgtaacattctcaggtgaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcattatgtccaaaagatattcatgttgtagaagat
ttaccgaaaacgcgtaattctaaagtaatgcgacgtgtcattaaagctgcttatttaggg
aaagaattaggtgatttatcgtcacttgtgaatcctgaggtagttccgtttattcagggg
ttgcagtctagtaaattataa

DBGET integrated database retrieval system