KEGG   Bacillus cereus NC7401: BCN_2461Help
Entry
BCN_2461          CDS       T01686                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bnc  Bacillus cereus NC7401
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bnc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bnc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2427933..2428667
Genome map
AA seq 244 aa AA seqDB search
MFKGAGDLKLKELANLLLVKETIGDMNVKITGLEMDSRKITNGNLFICVSGIDGFLKDRH
QFVEDAVKNGAVALIVERDVNIEIPKIIVKDARYAMAVIASHFYGYPSNKMKLIGITGTN
GKTTTSYLLEKILSDYGYHTGLMGNNGVKVGSKWYPTDINTQEPPTLQRNLQMMKNQNAD
YCVMEVTSQGLHMERVKGCNFKIAVFTNLTQDHLDYHETFDEYKHVKSLLFARLGNDLST
IDKK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagggggcgggagatttgaaactaaaagagctggcgaatttgttattggttaaa
gaaactattggcgatatgaatgtaaaaattacgggattagaaatggattctagaaagata
actaatggaaacctatttatatgtgtatcaggtatcgatggttttcttaaagatcgacat
caatttgttgaagatgcagtgaaaaatggtgctgtagcactaattgtagaaagggatgta
aatattgagatacctaaaataattgttaaagatgctaggtatgctatggcagttattgcg
tcacatttctatggttatccatctaataaaatgaagttaattggaattacagggacaaat
gggaaaacaactacttcctatttacttgaaaaaattttaagtgattatggatatcacacg
gggctcatggggaataacggagtgaaagttggttcaaaatggtatcctactgatattaat
acgcaagaacctccaacacttcaacggaatttgcagatgatgaaaaatcaaaatgcagat
tattgtgttatggaagttacgtcacaagggttacatatggaaagagttaaagggtgtaac
tttaaaatagctgttttcacaaatttaacacaagatcatttagattatcatgaaacattt
gatgaatataagcatgtaaaaagtcttctttttgcgagattaggaaatgatttatctact
atagataaaaaatag

DBGET integrated database retrieval system