KEGG   Bacillus cereus NC7401: BCN_2633Help
Entry
BCN_2633          CDS       T01686                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00010  Glycolysis / Gluconeogenesis
bnc00020  Citrate cycle (TCA cycle)
bnc00620  Pyruvate metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01130  Biosynthesis of antibiotics
bnc01200  Carbon metabolism
Module
bnc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCN_2633
   00020 Citrate cycle (TCA cycle)
    BCN_2633
   00620 Pyruvate metabolism
    BCN_2633
Enzymes [BR:bnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCN_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N HlyD_D23 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: BAL18426
Position
complement(2578146..2579345)
Genome map
AA seq 399 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDHVSKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKLNEKVEINESINVVEEKAPNLEPKKVQHPEPYAKEVAKKRIK
ISPVAKKIAKSENLDIKALVGTGPGGRIIKVDVLKAIEERVTIPEVLEQEESKVIPVTGM
RKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAAVVQKRYDNKLTITDFVSRAVVL
ALGEHKEMNSAYMDDTIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKQIKNVAQ
KAREGSLSSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKIKK
GSMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttaggtatggcgatgaaagaaggtattattacg
agctggaatattaaagcaggcgatcatgtctcaaaaggtgaactaattgctagtattaat
tcggaaaaaatcgaaacggaaatagaagcaccagctgatggaactgttcttgatatagct
gttagtgaagatgagggagttccacctggcactgtcatttgctatatcggtaagctgaac
gaaaaagtagaaatcaatgaaagtataaatgttgtagaagaaaaagcacctaatctagag
cctaaaaaggtccaacatccagaaccatatgcgaaagaagtggcgaagaaaagaatcaaa
atttcacctgtagcgaagaaaattgcaaagtctgaaaatctagatatcaaagcattagtt
ggtacaggccctggcggaaggattataaaagtagacgtattaaaagcgattgaagaaaga
gtaacaattccagaagtacttgaacaagaagaaagtaaagtaattcctgttactggtatg
cggaaagcaatcgcaaaccgtatgcatgcaagtttacaaaatagtgcgcaattaacatta
acgatgaaagtagatgtgacagatttagttgctttacataaagaaatagcggcagttgta
caaaaacgatacgataacaaactaactattacggatttcgtttctcgtgctgttgtatta
gcacttggagagcataaagaaatgaacagcgcttatatggatgatacaattcatcaattt
gaacatgttcatttaggcatggcagtcgcattagaaaaaggattagtcgttccagctatt
cgctttgctaataatctatctttagtagagttatctaaacaaattaaaaacgttgcacaa
aaagcaagagaaggtagtttaagtagtgatgatatgcaagggacaacctttacaattagt
aatttaggtagcttcggtattgaatattttacgccagtattaaatacacctgaaactggt
attttaggtgtaggtgcaattgaacatgttccagtatataaagggaagaaaataaaaaaa
ggcagtatgttacctttaagtttaacattcgatcatcgtgtattagatggtgcaccagca
gctgcatttttacgcacaattaaacgttatttagaagaacctgtaacaattcttttataa

DBGET integrated database retrieval system