KEGG   Bacillus cereus NC7401: BCN_2842Help
Entry
BCN_2842          CDS       T01686                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bnc  Bacillus cereus NC7401
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCN_2842
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCN_2842
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCN_2842
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BCN_2842
Exosome [BR:bnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCN_2842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2770075..2771748)
Genome map
AA seq 557 aa AA seqDB search
MFVLGLKMKKLLLVGTITLSMLCTESMMNDHTVEAKVKKVERQPKNVIMMVMDGTSSSAT
TLARLYKGKPLALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGFVGVLPTIVSS
PGLKPIKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHLNRKNFEVLAE
QQVYQNIDVVLGGGKAALLPETDSGIRKDGEDLVKVIQNKGYDFIETKEALLKSKSNKIW
GSFSHNALAFDMNREATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDP
IGMISDVLAFDHAVAEALRFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPVSAYI
DPLKKAKMTLEGTINNLKSDLSNVEEVAKLYGLDNLTYDEKERLKVVKKKIDVGPIFTTL
LANRANIGFTTGGHTGEDVFLYSYGPQKPVGLIQNTDVAKTIAKAMGFNLEEVTNKLFVE
SELAFKQNGATVTIDKTDVANPVLIVKHNNVTAQLFVNKNIIRIKNKDYELGSVVVESNG
KFYVPEEASRLFIKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtattgggtttaaagatgaagaagttactgttagtaggaacaatcacactaagt
atgttatgtactgaaagtatgatgaatgatcatacggtggaagctaaagtgaaaaaagta
gaacgacaaccgaaaaatgtaatcatgatggttatggacggaacgagttcttcagcaacc
acattagctcgcttgtataaagggaaaccacttgcattagatgaaattgtaacaggagga
gttcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcaacggggaataaatcgaattcaggatttgtaggggtattacctacaattgtgagttca
cctggcttaaaaccaataaaagaagaggacaagttacggccagttgccaatgttttagaa
ggtgccaaacgtactggtcgcgctactggaattgttgctacagctgaaattcagcatgct
actcctgctggattctccgctcatcatttgaatcgtaaaaattttgaagtgctcgcggag
caacaagtatatcaaaatatagatgtcgtattaggcgggggaaaagcagcacttctacct
gagacagatagtgggattcgaaaagatggtgaagatttagtaaaagtgattcaaaataaa
ggctacgactttattgaaacgaaagaggcattattgaaatctaaatctaataaaatttgg
ggctcattctcacataatgccttagcatttgatatgaatcgtgaagcaacaaatccggag
caaccaacactttcgcaaatgacggaaaaagccattcaaacgttatcaaaagataaagat
gggttctttttatttgtggaaggaagtaagccagattgggctgcacatgtgaatgatcca
attgggatgattagtgatgtgttagcatttgatcatgcagttgcagaagcattaagattt
gcaaaaaaagatggtaatacgatgctaatagccgtagcggaccatggtaacagcggtatt
tctattggcaatatgaatacgacaaaaggttataatactacgccggtctctgcatatatt
gatccattgaaaaaagcgaaaatgacacttgaagggactatcaataatttgaaatctgat
ctatccaatgtagaagaggtagctaaattatacgggttggacaatttaacttatgatgaa
aaagaaaggttaaaagtggttaaaaagaaaatagacgtaggtccaattttcactacatta
ttggctaaccgtgcgaacataggctttacaacaggaggtcatactggtgaggatgtattt
ttatattcatacggccctcaaaagccagttggtttgattcaaaacacggacgttgcaaag
acaatagcgaaagcgatgggctttaatttagaagaagtaacaaacaaattatttgtagag
agtgaattagcctttaagcagaatggtgcaactgtaacaatagataaaactgatgtagcg
aatcctgtactcatagtaaaacataataatgtaacagctcaattatttgttaacaaaaat
ataattcgtattaagaataaagattatgaactaggaagtgttgttgtagaaagcaatggt
aagttctatgtaccagaagaagcaagtcgtttattcataaagcattctcgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system