KEGG   Bacillus cereus NC7401: BCN_3700Help
Entry
BCN_3700          CDS       T01686                                 

Definition
(GenBank) guanylate kinase, putative
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00230  Purine metabolism
bnc01100  Metabolic pathways
Module
bnc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BCN_3700
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BCN_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase MMR_HSR1 AAA_33 Rad17
Motif
Other DBs
NCBI-ProteinID: BAL19493
Position
complement(3628560..3629177)
Genome map
AA seq 205 aa AA seqDB search
MRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKER
EEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGV
FIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVENDQVELACERI
KAIVVGEHCRRERVAKYYKEMTEGL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtagaagaggattgctcatcgttctttcaggaccttctggggttggtaaagga
acggttcgaaaagagctgtttagtcatgaggatacacgttttcagtactccatttcagta
acgacacgtaagccacgtgaaggtgaagtggatggtgtggattatttctttaaagagaga
gaagaatttgaggaaatgattcgtaatgaaaaattacttgagtgggctgagttcgtaggt
aattattacggaacaccaattgactatgttgaaaaaacattacaagaaggaaaagatgta
ttcttagaaattgaagtgcaaggagcaattcaagttaagaaagctttcccagaaggtgta
tttattttcttagcacctccaagtttatctgaactaaagaaccgaattgtcggtcgtggt
acagaaactgaagatgttattgaaaatcgtttaacggtagcgaaagaagaaattgatatg
atggacgcttacgactacgttgtagaaaacgaccaagttgaactagcttgtgaaagaatt
aaagcaattgtggttggcgaacattgccgccgcgaaagagtagcaaaatattataaagaa
atgacggagggtctataa

DBGET integrated database retrieval system