KEGG   Bacillus cereus NC7401: BCN_3720Help
Entry
BCN_3720          CDS       T01686                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00240  Pyrimidine metabolism
bnc00250  Alanine, aspartate and glutamate metabolism
bnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BCN_3720
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCN_3720
Enzymes [BR:bnc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BCN_3720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C DUF2002
Motif
Other DBs
NCBI-ProteinID: BAL19513
Position
complement(3649138..3650052)
Genome map
AA seq 304 aa AA seqDB search
MSHLLTMSELSEVEISEILKDAEDFANGKESKTTEQTFVANLFFENSTRTRFSFEVAEKR
LGLDVLNFSADASSVQKGETLYDTIRTLESIGTKAVVIRHEQDRYFDELKDQVNIPILNA
GDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKLGATIYFAS
PEEWKDEDNTFGTYKPLDELVPEVDVMMLLRVQHERHDHYETDIMKEYHEKHGLTVEREK
RMKEGSIIMHPAPVNRDVEIASELVECERSRIFKQMENGVYVRMAVLKRALPNVLGGMKH
ELFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgttaacgatgagtgaattatcggaagtagaaatttcagaaatcctaaaa
gacgcagaagattttgcgaatgggaaagagagcaaaacgacagagcaaacttttgttgcg
aacttgttctttgagaatagtacgagaacaagatttagctttgaagttgctgagaagaga
ttaggacttgatgttttaaacttttcagctgatgcatctagcgtacaaaaaggagaaact
ttatacgatacgataagaacactagaatcaatcggaacaaaagcagtggtcatccgccat
gagcaagatcgctacttcgatgaactaaaagatcaggtgaatatcccgatcttaaacgct
ggagatggatgtggaaaccacccaacgcagtgcctactcgaccttcttacaattaaacaa
gagtttggaagatttgaaggtttgaagattgcaatagtaggagatgttcgtcatagccga
gtagcacgttctaatgcagaagcattaacgaagctaggtgcaacaatttactttgcaagt
ccagaagagtggaaagatgaagacaacacatttggaacatacaaaccattagatgaactt
gttccggaagtggatgtaatgatgttacttcgtgtacaacatgagcgtcatgatcattat
gaaacagacattatgaaagagtatcatgagaaacacggattaacagtggaaagagaaaag
cgtatgaaagaaggaagcattattatgcatccagctcctgtaaaccgagatgttgaaatt
gcaagtgaacttgttgagtgtgagcgttcacgcatatttaaacaaatggaaaatggagtt
tacgtaagaatggctgtactaaaacgcgccttaccaaatgtattaggaggaatgaaacat
gaattatttgtttaa

DBGET integrated database retrieval system