KEGG   Bacillus cereus NC7401: BCN_3938Help
Entry
BCN_3938          CDS       T01686                                 

Definition
short-chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bnc  Bacillus cereus NC7401
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BCN_3938
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BCN_3938
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BCN_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3829643..3830419
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGNAFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAIGLKC
DVTSEEEIEASISQTVTHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAV
KHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtttttttaacaggtgctgcaagtggtattggatatgaaatg
ggaaacgcttttgcaaaagaaggggcaaaagttgttattaccgatcgtcttgaagaacgt
gcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatcggcttaaaatgt
gatgttacatccgaagaagaaatagaagcatccatttctcaaactgttactcatttcggt
tcattagacatattaattaataacgcaggcatgcaacacgtttcaccaattgaagatttt
ccaaccgaaaaattcgagctactcattaaaattatgcaaatcgctccttttatcgccgtt
aagcatgcctttcccattatgaaaaagcaaaaatatggccgaattattaatgtagcttcc
attaatggcctcgttggattcgctggaaaagctgcttataatagcgcaaaacatggtgta
attggattaacaaaagttgccgctttagaaggggctactcacggaattactgttaatgcg
ctttgtcccggttatgtcgatacccctctcgtacggaatcaattacaagacttggccact
acacgaaatgtaccacttgaaaatgttttagaggatgtcatttatccacttgtcccacaa
aaacgcttattacaagtacaagagattgctgattatgcgatgtttttagcgagcgaaaaa
gctaaaggtataactggacaagctgtcgttatcgatggtggttatactgctcaataa

DBGET integrated database retrieval system