KEGG   Bacillus cereus NC7401: BCN_3951Help
Entry
BCN_3951          CDS       T01686                                 

Definition
5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bnc  Bacillus cereus NC7401
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCN_3951
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BCN_3951
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BCN_3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3840708..3841220
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEINTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLKENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaaataaatactcgcattgaaaatgaagtggaagtatca
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttccaaacttcctact
catttaaaagaaaattactcattaacagatgaaaacaaagctgaaatattagctgtgttt
tcaaaagaaattgctgatgtttcagcacgccgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaattattaattaattttcaaaaagaacaccat
catactgatgatgaagttcgctttattgttagtggtcatggcatctttgccattgaagga
aaagatgggacattctttgacgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gttacaactgaaggttgggttccaatctattaa

DBGET integrated database retrieval system