KEGG   Bacillus cereus NC7401: BCN_4554Help
Entry
BCN_4554          CDS       T01686                                 

Definition
(GenBank) acetyl-CoA synthetase, putative
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00010  Glycolysis / Gluconeogenesis
bnc00620  Pyruvate metabolism
bnc00640  Propanoate metabolism
bnc00680  Methane metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01130  Biosynthesis of antibiotics
bnc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCN_4554
   00620 Pyruvate metabolism
    BCN_4554
   00640 Propanoate metabolism
    BCN_4554
  Energy metabolism
   00680 Methane metabolism
    BCN_4554
Enzymes [BR:bnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCN_4554
Lipid biosynthesis proteins [BR:bnc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCN_4554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAL20347
Position
complement(4385699..4387267)
Genome map
AA seq 522 aa AA seqDB search
MAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIKSGLQKG
DKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSYEPYIGQ
FDDIEAMESLQKFVLSEQPVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTSGTTGNP
KGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGATGFVYH
GKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPLNREVIE
TFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGIPVQVGEV
GDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDDIIISSG
YTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIPILQQHV
KELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccaccgtcttataatttagtttctgaaatagagaaatatacaggtgataaagag
aagcttgctttaatttggcaagatgataaagggaatcgccgagaagttacatacgcggag
ttaatgaaaggtgcaaataaaattggaaacgcttttataaagagtggtctgcaaaagggg
gacaagctcctcattatgatgccgcgtttaattgaagcatacatgacgtatatcgctgcg
attaaagcaggatttgtcgtaattccgagttcggaaatgttacgcaaaaaggatatcgag
taccgcattggacatggggaagtaaaagcaatcgtaagttatgagccgtacattggacag
tttgatgatatagaagcgatggaatcccttcaaaaattcgttctgagcgagcagccagta
gatggatggatcaatttaaaaacagcgttagaaacagaaagtgacatgttagaaatggcg
aagacagataaagaagatatggtctttttatcttacacgtcaggaacgacgggaaatcca
aaaggtgttgttcatacacatgcgtgggcatacgctcatttacgtacgagcgctccaaat
tggctcggaattgaagagaatgatgttgtgtgggcaacagctagtccaggctggcagaag
tggatttggagcccgtttttagcaactctaggctcgggggcaacaggatttgtataccac
ggtaagtttgaaccaaaaacgtatttaaatttattagacgataataaggtgaatgtgctt
tgttgtacgccgactgagtatagattaatggcaaaagtagaaaatttaagtgaatacaat
ttagaagcgttacatagcgctgtatccgcaggtgagccgttaaatagagaagtcattgaa
acgttccaaaagcactttcatattacagtaagagacggctatgggcaaacggaaaacaca
ttgcttgttggtgtaatgaaaggaatggatattagaccaggatcaatggggaaaccgacg
ccgggtaaccacgttgatattgtaaatgaggaaggtattccggtacaggtaggcgaagtt
ggtgatattgcagttcacattgaaacgccggcactctttaaacaatattacaaagacgat
gagcgtacagcgatgcaattccgcggtgattattatattacaggtgataaagcgaaaaaa
gatgaagacggctatttctggtttgaagggcgcggtgatgatattattattagctctggt
tatacaatcgggccgtttgaagtagaagatgcgctcgtaaagcacccttacgtgagagaa
tgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtcgtgaaggcatttatcgta
ttaagagagaatatagaaaagaacgaagaaacattaattccaatactccaacaacacgtc
aaagaacttactgcaccatataaataccctcgcaaaattgaatttgtagatgaactacca
aaaacgatttctggaaaaatccgccgtattgagcttagaaaacaagagatggagattccg
tcaaaataa

DBGET integrated database retrieval system