KEGG   Bacillus cereus NC7401: BCN_4613Help
Entry
BCN_4613          CDS       T01686                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bnc  Bacillus cereus NC7401
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bnc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bnc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4437902..4439308)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDNLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGETE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMILGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFESGRRLNMVPDFAEAVVTGEDVSALTVAY
EEYLQTAKKIGEAIVEGNTVTLQIKGVSAHGSTPEKGENAGLLLANFLTKVALDGKGESF
VSFATETFTGDTLGEKAGISYKDDISGPLTVNVGRLSYTKENGGNLGLNVRYPVTTNFEE
MIAKLKEYVGNHGFEVADYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIYELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaattaattggacagaagaagttgcaaaacgaaaagataatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagagggcgca
ccattcggtgaaggtgtagaaaaagctttatctttcatgttacataaaggagaaacggaa
ggctttacttctaaaaatttagaagggtatgcaggtcatcttgaaatgggacaaggagaa
gaattagtaggtattctttgtcacgttgatgttgtaccagaaggagatggctggacgact
cctgcatatagtgcagatattcgtgatgggaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcttactatgcgatgaaaattgtgaaagaattaggtttacct
ctttcaaaacgtgttcgtatgattttaggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcgccagacgcggacttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaagaaaggtacatatgaacttgtttcatttgagtcaggtcgccgtttaaatatggtt
cctgattttgcagaagcggttgttacaggagaggatgtaagtgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaataggtgaagcaattgtagaaggtaatacagta
acgttgcaaattaaaggggtttcagctcacggatctactcctgaaaaaggagaaaatgca
ggtttattactggcaaacttcttaacgaaagttgctcttgatggaaaaggggaatcgttt
gtatcgtttgcaacagaaacatttacaggagatactttaggagagaaagctggtatttct
tataaagacgatattagtggtccattaacagtgaatgttggtcgtctttcttatacgaaa
gaaaatggtggcaatttaggattaaacgtacgttacccagttacgactaactttgaagaa
atgattgcaaagttaaaagaatatgtgggtaatcatggatttgaagtagctgattattca
aactctcgtccgcatcacgttgataaagaccacgtattaattcgtacgttgcagcgcgta
tatgaagaacaaacaggtgaaaaagcagaactattagcaattggcggtggtacttacgct
cgttcgttaaaagctggtgttgcatttggcccattgttccctggaaaagaagaacttgcg
catcaaaaagatgagtatattgaaattgaagacttattaaaggcaacagcaatttacgcg
caagcaatttatgaattagcgaagtaa

DBGET integrated database retrieval system