KEGG   Bacillus cereus NC7401: BCN_4786Help
Entry
BCN_4786          CDS       T01686                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bnc  Bacillus cereus NC7401
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCN_4786
Enzymes [BR:bnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BCN_4786
Exosome [BR:bnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCN_4786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4595354..4597291)
Genome map
AA seq 645 aa AA seqDB search
MSVINCEEVKRDEFHTEKYYDSYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFIPHIEEKEIYKYAIETTAGDVIFKADPYAVYAEVRPNTASV
VFDIKGYEWNDKNWSRKKKKKSVYKEAMTVYELHFGSWKKKEDGTLYSYREMAEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRY
FHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHEKMTFSLLYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSPEGFQWIDANNNEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGVPDFEYYNEVLNSDAEQYGGSGQVNKKRLKAIQEPFHNQ
AAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtaataaattgtgaagaagtgaaacgagatgagtttcatacagaaaagtactat
gacagttataacatctttggcgcacatattgtgacggaagatgagatgcgaggtgtacga
tttacagtatgggctcctcatgcgaaagcaatgagtgttgttggagattttaatgaatgg
gattatgagcaacataagatgctacaagtgacagaagagggaatttggtccttatttata
ccgcatattgaagaaaaagaaatatataaatatgcgattgaaacgacggctggtgatgtc
atttttaaggcagatccgtatgctgtatatgcagaagtaagaccgaatacggcatctgta
gtttttgatataaagggatacgaatggaatgataaaaactggagtcgtaagaaaaagaaa
aaatcggtttataaagaagcgatgacagtttatgaattgcatttcggttcttggaaaaag
aaagaagatggaacgctgtattcttacagggaaatggcagaagaactcattccttatgtg
gtggaacatcaatttacacatattgaaattatgccccttgttgagcatccgtatgatcgt
tcttggggatatcaaggaacgggatattatgccgcaacgagtagattcggcacgccacat
gatttgatgtattttgtcgatgaatgtcataaatatggaatcggtgtcattttagattgg
gtgccggggcatttttgtaaagatgctcacggtttatatttgtttgatgggacaccgact
tatgaatataaagataaagatgtgcaagaaaatccagtatggggaactgttaactttgat
ttaggaaagagggaagtacgtaatttcttaatttcaaatgcgttattttggatgagatat
ttccacattgatggtttcagggtggatgcagttgcaaacatgctgtactggaataaagaa
ggacaagagcaaagtaatgagcacgctgtttcatttttacgggagttaaatgaagcggta
tttgcagaggatgaagatttccttatgacagcagaggattcaacagcttggccacttgta
acagctccaacgtatgaaggtgggcttggattcaattacaaatggaatatgggctggatg
aatgacgtgctgaagtatatggagtgtgcgccagagtacagaaaatatattcatgagaaa
atgacgttctctttactatatgcttactctgaaaatttcatattaccgctttctcatgat
gaagtcgttcatgggaaaaagtcgttattaaataaaatgccaggagactactgggataag
tttgctcaacttcgtttattatatggatatttctttactcatccaggaaagaaattactt
ttcatgggtggagaattcgggcagtttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgttatatgcatgattactttaaagagctcatagca
ttgtataagcgctccaaaccactttggcagcttgatcattcgcctgaaggatttcagtgg
attgatgctaataataatgagcaaagtattttctcttttatccgccaaggggataaacaa
gaagatgcgttagttgtcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtaccagatttcgagtattataacgaggttttaaacagtgatgctgagcaatatggc
ggatcagggcaagtaaataagaagcgtctgaaggcgattcaagagccgtttcataatcaa
gcagcacatgtagaaattacaattccaccatttggcgtatccatattacgaccagtgaag
acgagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system