KEGG   Bacillus cereus NC7401: BCN_4866Help
Entry
BCN_4866          CDS       T01686                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bnc  Bacillus cereus NC7401
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCN_4866
   01230 Biosynthesis of amino acids
    BCN_4866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCN_4866
  Energy metabolism
   00680 Methane metabolism
    BCN_4866
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCN_4866
Enzymes [BR:bnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCN_4866
Exosome [BR:bnc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCN_4866
  Exosomal proteins of melanoma cells
   BCN_4866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4671426..4671980
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSAAGQERHAELTTDGKKQANTLATFLLENQLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLAERILSDVSMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
EDVLKLNHTTILLVTHGNLLTLILKHFDHTIGFHEWRALTNPDMYEITIDEQCSLKRLWK
APSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcattgtaatacgacattgttcagccgctggacaagaacgtcatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattccttttagaaaaccaa
ctacaaatagatcatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcactccaagctaatttgtctatccaagaagatgaacgcttagctgaacgcatatta
agcgacgtttcaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacggaccgtgctatatcgcttatc
gaagacgttttaaaattaaaccatactacaatattactcgttacacatggaaacttactt
acgctcattttaaagcactttgatcatacgatcggctttcatgaatggagagctttaacg
aatcctgatatgtacgaaattacaattgatgaacaatgtagcctaaaacgattatggaaa
gcaccgtccaagtaa

DBGET integrated database retrieval system