KEGG   Bacillus cereus NC7401: BCN_5028Help
Entry
BCN_5028          CDS       T01686                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bnc  Bacillus cereus NC7401
Brite
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BCN_5028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4821070..4821810)
Genome map
AA seq 246 aa AA seqDB search
MKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEEL
VHTGPEDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMYI
KSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDMI
YAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYNF
LEQLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgttttatta
ctacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaaaag
aaaggctacacttgtcatgccccaatttataaagggcacggtgtaccaccagaagagctt
gttcatacaggtcctgaagattggtggcaagatgtaacggaggcatatcagcttttaaaa
gataaaggttttgagaaaattgctgtcgttggattgtcacttggcggagtattttcacta
aaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccaatgtatatt
aagagtgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaagcgt
gagcaaaaatcaccagagcaaatcgaacaagaaatgttggaattccaaaagacaccgatg
aatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggacatgatt
tatgcaccaacatttgttgtacaagcgcgtcatgatgaaatgattaatacagatagtgcg
aacattatttataacggtgtagaatcaacgttaaaagacattaaatggtatgaagactct
acgcatgtcattacacttgataagcagcgtgacgagctacatgaggatgtatataacttc
ttggagcaactagattggtaa

DBGET integrated database retrieval system