KEGG   Bacillus cereus NC7401: BCN_5201Help
Entry
BCN_5201          CDS       T01686                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bnc  Bacillus cereus NC7401
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCN_5201
   00052 Galactose metabolism
    BCN_5201
   00500 Starch and sucrose metabolism
    BCN_5201
   00520 Amino sugar and nucleotide sugar metabolism
    BCN_5201
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCN_5201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4992959..4993840)
Genome map
AA seq 293 aa AA seqDB search
MKKVRKVIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQAVPENETHRYGIIDPVEQNNR
RYQVRQFVEKPAQGTAPSNLAIMGRYVLTPEIFTFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGTRYDVGEKFGFIKTTIEMALQNKELNVELMKYMKELVEKEEVHS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagtaattattccagctgcgggactggggacaaggtttttaccg
gtaacaaaggcaatgccgaaagaaatgttaccaattgttgataaaccaacaattcaatac
atagtagaagaagcgatagaatcaggaattgaagatattattattgtgactggaaaaggt
aaacgtgccattgaagatcattttgatcattcttttgaactagaacaaaaccttttagaa
aaaggaaagtatgaaatgcttgagaaagtacaagcatcttcaaagattaacattcattat
ataagacagaaagaaccgaaagggcttggacatgcagtatggtgtgcacgcaaatttatt
ggaaacgagccatttgcggtattacttggtgatgatattgtacaagctgaaacgccatgt
ttacgtcaattgatggatcaatatgaaggaacacaatcatcggttattggtgtacaagca
gtaccagaaaatgaaacacatcgttacggtattatcgatccagttgaacaaaacaatcgt
cgttatcaagtgcgtcaatttgtagaaaagccagctcaaggtacagcaccatcaaattta
gcaattatgggacgttacgtattaacaccagaaatttttacgttccttgaaaatcaacaa
acaggtgctggtggagaaattcaattgacagatgcgattcaacgtttaaatgaaattcaa
cgagtatttgcgtatgatttcgaaggcactcgttacgatgttggggagaagtttggattt
attaagacgacaattgagatggcactacaaaataaagaattaaatgtagagttaatgaag
tatatgaaagaacttgtagaaaaagaagaggtacattcataa

DBGET integrated database retrieval system