KEGG   Bacillus cereus NC7401: BCN_P190Help
Entry
BCN_P190          CDS       T01686                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00010  Glycolysis / Gluconeogenesis
bnc00260  Glycine, serine and threonine metabolism
bnc00680  Methane metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01130  Biosynthesis of antibiotics
bnc01200  Carbon metabolism
bnc01230  Biosynthesis of amino acids
Module
bnc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bnc_M00002  Glycolysis, core module involving three-carbon compounds
bnc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCN_P190
  Energy metabolism
   00680 Methane metabolism
    BCN_P190
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCN_P190
Enzymes [BR:bnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCN_P190
Membrane trafficking [BR:bnc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCN_P190
Exosome [BR:bnc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCN_P190
  Exosomal proteins of melanoma cells
   BCN_P190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAL21398
Position
pNCcld:complement(190463..191032)
Genome map
AA seq 189 aa AA seqDB search
MLTNLYLVRHAHSTYTPEELKRPLSEKGLKDAYKVKELLREENIDHVISSPYLRAIQTVE
GIALTLGREIQIVDEFKERKLTKEDVNDFEQAIRKVWDNPDFSWEGGESNKSAQQRGIKG
IEMALDKYEGKNVVVGTHGNIMVLMMNYFDEQYDFEFWKKLAMPDIYKLSFQKKTLVNCI
RIWKDSNLI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctaacaaatttgtatttggttagacatgcccattctacttacacaccagaggaatta
aaaagacccttatcagaaaaaggactaaaagatgcttacaaagtcaaagagttactaaga
gaagaaaacattgatcatgttatctcaagtccatatttaagggctatacaaacggttgaa
ggaatagcattaacactgggcagggagattcaaattgtagatgaatttaaagaaagaaag
ctaacgaaggaagatgttaatgattttgagcaagcaattagaaaggtttgggacaaccct
gatttttcttgggaaggtggagagtcaaacaagagtgcccaacaaagaggaattaaaggc
attgaaatggctttagataaatatgaaggcaaaaatgttgttgtaggaacacatggaaat
attatggtactaatgatgaattattttgatgaacaatacgattttgaattctggaagaag
cttgctatgccagatatatataaactttctttccaaaaaaaaaccttagttaattgtata
agaatatggaaagattctaacttaatttaa

DBGET integrated database retrieval system