KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_01110Help
Entry
BANAN_01110       CDS       T02047                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bni00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BANAN_01110 (recR)
DNA repair and recombination proteins [BR:bni03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BANAN_01110 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
258784..259386
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDVESQRLVDAINEVKEKVRFCE
VCGNVCESSPCTICSDPRRDHSTICVVEEPKDVMSIERTREYRGLYQVLGGAINPMANVG
PSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLAPLDIKVTRLASGLPVGG
DLEYADEITLSRALEGRREV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcatacgacggcgccattcagcggctcatcgactcgttcgcgagtctgccg
ggcatagggcccaagggcgcgcaacgcatcgccttctatctgctgcaggcaccagatgtg
gagtcgcagcgtctcgtcgatgcgatcaacgaggtgaaggagaaagtgcggttctgcgag
gtctgcgggaatgtgtgcgaaagcagcccgtgtacaatctgctcggatccgcgtcgtgat
cacagcacgatctgcgtggtggaggagccgaaggacgtcatgagcatcgaacgcacgcgc
gaataccgcgggctctaccaggtgctgggcggcgccatcaacccgatggccaacgttggc
ccgagcgacctcaacatcgcgcagctgctcaacagactccacgacggcgaggtcaaggag
attatcgtggcgctcaacccgaacatcgagggcgaggcgaccaccacctacctgagccgc
ctgctcgcgccgctcgacatcaaggtgacgcgtctggcgagcggtctgccggtgggcggc
gacctcgaatacgccgacgaaatcacgttgtctcgcgcgctcgaagggcgtcgtgaggtg
tga

DBGET integrated database retrieval system