KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_01110Help
Entry
BANAN_01110       CDS       T02047                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bni00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BANAN_01110 (recR)
DNA repair and recombination proteins [BR:bni03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BANAN_01110 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
258784..259386
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDVESQRLVDAINEVKEKVRFCE
VCGNVCESSPCTICSDPRRDHSTICVVEEPKDVMSIERTREYRGLYQVLGGAINPMANVG
PSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLAPLDIKVTRLASGLPVGG
DLEYADEITLSRALEGRREV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcatacgacggcgccattcagcggctcatcgactcgttcgcgagtctgccg
ggcatagggcccaagggcgcgcaacgcatcgccttctatctgctgcaggcaccagatgtg
gagtcgcagcgtctcgtcgatgcgatcaacgaggtgaaggagaaagtgcggttctgcgag
gtctgcgggaatgtgtgcgaaagcagcccgtgtacaatctgctcggatccgcgtcgtgat
cacagcacgatctgcgtggtggaggagccgaaggacgtcatgagcatcgaacgcacgcgc
gaataccgcgggctctaccaggtgctgggcggcgccatcaacccgatggccaacgttggc
ccgagcgacctcaacatcgcgcagctgctcaacagactccacgacggcgaggtcaaggag
attatcgtggcgctcaacccgaacatcgagggcgaggcgaccaccacctacctgagccgc
ctgctcgcgccgctcgacatcaaggtgacgcgtctggcgagcggtctgccggtgggcggc
gacctcgaatacgccgacgaaatcacgttgtctcgcgcgctcgaagggcgtcgtgaggtg
tga

DBGET integrated database retrieval system