KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_01595Help
Entry
BANAN_01595       CDS       T02047                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00330  Arginine and proline metabolism
bni00332  Carbapenem biosynthesis
bni01100  Metabolic pathways
bni01130  Biosynthesis of antibiotics
bni01230  Biosynthesis of amino acids
Module
bni_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BANAN_01595
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BANAN_01595
Enzymes [BR:bni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BANAN_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFI62541
Position
383179..384312
Genome map
AA seq 377 aa AA seqDB search
MQTPSQEEVRRAVAAARTVVVKVGSSSLTQPSGHLDVDKLNALVGAIAQVRMLGGNIVLV
SSGAIAAGFGPLGFESRPTDVATQQATASVGQGLLMAQYEMAFGRYGIRVGQLLITAEDT
MQPRQYRNARRTMAKLLELGVVPIVNENDALASNEIRFGDNDRLSALIANMVCADALILL
TDVDALYTAPPSEPGSHRIGFVPNITELLDQVRVGGSESGVGTGGMVTKLEAARMAAVSG
IPAVLTAARNAGPALMGDEVGTAFAPVKQRGSARRLWIKFAAHPRGVLVADSGAAKAVRG
GRASLLAAGVLESRGDFAAGDPVWIDDEAGNHLARGLAGYDSEEIPNMLGRNTAQLRRLL
GEEYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgtcccaggaggaagtacgccgtgcggtggcagccgcgcgaaccgtggtg
gtgaaggtggggtcgagctcgctcacgcagccctccgggcacttggacgtagacaagctc
aatgcgctggtgggcgcgatcgcgcaggtgcgcatgctcggcggcaacatcgtgctcgtc
tcgtccggcgccatcgccgcgggtttcggtccgctcggcttcgaatcgcgccccaccgat
gtggccacacagcaggcgaccgcgtcggtggggcagggactgctcatggcccagtacgag
atggcgttcggccgctacggcattcgcgtggggcagctgctcatcaccgccgaagacacg
atgcagccacggcagtaccgcaatgcgcggcgcaccatggccaagctgctcgaactcggc
gtggtgccgatagtcaacgagaatgatgcgcttgccagcaacgagatccgtttcggcgac
aacgaccggctttccgcgctcatcgcgaacatggtgtgtgccgatgcgctgattctgctc
accgatgtcgacgcgctctacaccgcacctccaagcgagccgggctcccatagaatcggc
tttgtgccgaacatcaccgaactgctcgaccaggtgcgtgtgggcggttcggagtcgggc
gtgggcaccggcggtatggttacgaagctcgaggccgcgcgcatggccgccgtctccggc
attccggccgtgctcaccgccgcccgcaacgccggtccggcactcatgggcgatgaggtg
ggcaccgcattcgctccggtgaagcaacgcggttcggcgcgcaggttgtggatcaaattc
gcggcccatccgcgtggagtgctcgtggccgattccggcgcggccaaggcggtgcgcggc
ggacgggcgagtctgcttgctgcgggtgtgctcgaatcgcgtggtgatttcgccgccggc
gacccggtgtggatcgacgacgaggcgggcaatcatctggcgcgcggccttgccggttac
gattccgaggagattccgaacatgctcggacgcaacactgcgcagctgcgccgcctgctc
ggcgaggagtatgcgcacccgctcgtgcaccgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system