KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_01960Help
Entry
BANAN_01960       CDS       T02047                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bni00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475704..477872
Genome map
AA seq 722 aa AA seqDB search
MTELNEESPERLARPLIRLAQSLGVATSYVGMSRDFHEIPDDVLVAVLKALNVDASSEET
IEASLEHVNNQRAMRLIEPTVLHIVGEQTHVPIHLAITEAPKVTITLEDGTIYQHDITVE
PLPDVKVHEVNGKFFSTAQIALPADLPEGYHTLHIAAGQREADATLISAPQRIPLLDPLK
NGSLWGWMAQLYSIRSADSWGVGDFADLRTLLIDSKRYTNADFMLINPVHAGEPVSPLTP
SPYLPVSRRFINFTYIHPEDIPEYYALDDAAKQSVKDAHAKMEAYNADPNLIDRDAMWLE
KEKALRTIFNAGLQSVRQQAFDDYKAKCGEDLEAYATWCVCYAKWGKPENTPDNWINKYT
KDSPEVKQLREQNSDLLEFYRWLEWIAVEQMHAAQQAARQAGMQIGIMSDMAVGVHPDGS
EVWWNPERFANGASVGAPPDMFNQQGQNWSQPPLSPLSLKETGYKAYREMVRGMFDCAGA
VRIDHILGLFRLWWIPEGQPASNGTYVYYDHNTMLGILAIEADRVGGLIVGEDLGVMPSY
VQQSLADHAIFGCAVEWFEQMDGVFIPPKDWRPYALASVDNHDMPPAAGYLEYEHVRVRE
QLGLLGEDSSAFERSARAEHQAMLQMLVDNGYLDVNVMKDESGRWEEIVEALYRALNSSP
CKLKAVSFVDAVGERRTQNQPGTDNEYPNWRVPLADYHGDNVPLEHLFDSDLLQRIAKIM
NS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactcaacgaagaaagcccggagcgtcttgcgcgcccccttattcgtctcgcg
cagtcgctgggcgtggcgaccagttatgtcggcatgtcgcgtgatttccatgagattccc
gatgacgtgctcgtggccgtcctgaaggccctcaatgtcgatgcctccagcgaagagacc
atcgaagcgtcgttggaacatgtgaacaaccagcgcgccatgcggctcatcgaacccacc
gtgctgcacattgtgggcgagcagactcacgtgcccatccatctggccatcaccgaggcg
ccgaaggttacgatcacactcgaagacggcaccatataccaacacgacatcacggtggag
ccgctgcccgacgtcaaggtgcatgaagtcaacggcaagttcttctcgacggcgcagatc
gcactgcctgccgacctgcccgagggctaccacacgctgcacatcgcggcagggcagcgc
gaggcggatgcgacgctgatcagcgcgccacagcgcatcccattgctcgatccgctcaag
aacgggtcgttgtggggatggatggcccagttgtattcgatccgctcggccgactcctgg
ggcgtcggcgatttcgccgatctacgcacgttgctcatcgactcgaagcggtacacgaat
gccgacttcatgctcatcaacccagtgcatgccggcgaaccggtctcaccgctgaccccg
tcgccatacctgccggtgtcgcgtcgcttcatcaacttcacctacattcacccggaggac
attcccgagtactacgcgttggacgatgccgccaagcagtccgtcaaggacgcacacgcc
aaaatggaggcctacaacgccgatccgaacctgatcgaccgcgatgccatgtggctcgag
aaggagaaggcgctgcgcacgatcttcaacgcaggcctgcagtcggtgcgccagcaggcc
ttcgacgactacaaggccaagtgcggcgaggatctcgaggcatacgccacctggtgtgtc
tgctatgcgaagtggggcaagcccgagaacacgcctgacaactggatcaacaaatacacg
aaggattcccccgaggtcaagcagctgcgcgagcagaacagcgacttgctcgaattctac
cgttggctcgagtggattgcggtcgagcagatgcatgcggcccagcaggcggcacgtcag
gccggcatgcagatcggcatcatgagcgatatggccgtcggcgtccatccggacggctcc
gaggtgtggtggaacccggagcgattcgccaacggcgcctccgtgggtgcgccgccggac
atgttcaaccagcaggggcagaactggagccagcccccgttgagcccgctctcgctcaag
gaaaccggctacaaggcgtaccgcgagatggtgcgtggcatgttcgactgcgccggcgcc
gtgcgcatcgaccacattctcggcctgttccgcctgtggtggatcccggagggccagccg
gcctcgaacggcacctacgtgtactacgaccacaacacgatgctgggcattcttgcgatc
gaggcagaccgcgtcggcggcctgatcgtgggcgaggacctcggtgtcatgccgtcgtac
gtacagcagtcgctcgccgaccatgccatcttcggctgcgccgtcgaatggttcgagcag
atggatggcgtgttcattccgccgaaggattggcgcccgtatgcgttggcctcggtggac
aaccacgacatgccgccggcggccggctatctcgagtacgagcatgtgcgcgtgcgcgaa
cagctcggtctgctcggcgaggattcgtcggccttcgagcgcagcgcgcgcgccgagcat
caggccatgctgcagatgctcgtcgacaacggctacctcgatgtcaatgtgatgaaagac
gaatccggcagatgggaggagattgtcgaggcgctctaccgtgcgctcaacagctcgcct
tgcaagctcaaggccgtctccttcgtcgacgcagtgggagagcgccgcacgcagaaccag
ccgggcaccgacaacgagtatccgaactggcgtgtgccgttggccgactaccatggcgac
aacgtgccgctcgagcacttgttcgactccgatctgctgcagcgcatcgccaagatcatg
aacagctga

DBGET integrated database retrieval system