KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_01985Help
Entry
BANAN_01985       CDS       T02047                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BANAN_01985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAN_01985
   00620 Pyruvate metabolism
    BANAN_01985
   00650 Butanoate metabolism
    BANAN_01985
  Lipid metabolism
   00071 Fatty acid degradation
    BANAN_01985
  Amino acid metabolism
   00350 Tyrosine metabolism
    BANAN_01985
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BANAN_01985
   00626 Naphthalene degradation
    BANAN_01985
Enzymes [BR:bni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BANAN_01985
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BANAN_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483468..486215
Genome map
AA seq 915 aa AA seqDB search
MADKNSAETATKAAKPAVNVEDKKAAAQAEVDALVKKAQKALVEFEKLDQQAVDRIVAKA
SVAALNKHLVLAKLAVDETGRGLVEDKATKNIFACEHVTNYMAGQKTVGIIREDDVLGID
EVAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKSSVEAARIVRDAAI
EAGAPENCVQWIEHPSIEATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAP
AYVDNNVDVQRVANDLILSKHFDYGMICATEQAIIAHKDIYAPLVKELKRRKAYFVNDEE
KAKLEKYMFGCTAFSGETPKLNSVVPGKSPQYIAHEAGFEIPEDATILAAECSEVGENEP
LTMEKLAPVHAVLKFSDKEQGFEMCEEMLKHGAGHTAAIHTNNDDLVREYGLRMHACRII
WNQPSSLGGIGDIYNSIAPSLTLGCGSYGGNSVSGNVQAINLLNIKRIARRNNNMQWFKI
PAKTYFEPNAIKYLRDMYGIERAVIVCDKVMEQLGIVDKVIDQLRARSNRVTFRIVDYVE
PEPSVETVERGAAMMRDEFEPDTIIAVGGGSPMDAAKIMWLLYEHPEIAFSDVREKFFDI
RKRAFKIPPLGAKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDP
VLARTQPRRLASDAGFDALTHSMEAYVSVYANDFTDGMALHACKLIWDNLAESVNSEPGE
TKKKAQEKMHNAATMAGMAFGSAFLGMCHAMAHTIGALCHIAHGRTNSILLPYVIRYNGQ
VPEEPTSWPKYSKYIAPERYQELASLLGVDPGKTPAEGVENLAKAVEDYRDNKLGMNKSF
KDCGVDEDYFWSILEQIGMRAYEDQCAPANPRIPQIQDMMDIAIAAYYGVSQAEGHAMRV
EREGVGATEEASERV
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagaacagcgccgagaccgcaacgaaggcggccaagcctgctgtgaatgtg
gaagacaagaaggccgcggcacaggccgaggtcgacgctctggtcaagaaggcgcagaag
gcgctggtggaattcgagaagctcgaccagcaggccgtcgatcgcatcgtggcgaaggcc
tccgtggccgccctcaacaagcatctggtgctggcgaaactggcagtcgacgagaccggt
cgtggactcgtcgaagacaaggcgacgaagaacatcttcgcctgcgagcacgtgaccaat
tacatggccggtcagaagaccgtcggcatcattcgtgaagacgacgtgctcggcattgat
gaagtggccgaaccggtcggcgttgtcgcgggcgtcaccccggtgaccaacccgacgtcc
actgccatcttcaagtcgctcatcgccctcaagacccgttgcccgatcgtcttcggcttc
cacccgggtgcgcagaagagctccgtcgaagcggcgcgcatcgtgcgtgacgccgccatc
gaggcgggcgccccggagaactgcgtgcagtggatcgaacacccgtccatcgaggcgacc
ggcgcgctcatgcagcatcccggcgtggccacgatcctcgcgaccggcggccccggcatg
gtcaaggccgcgtactcgtccggcaagccggccctgggcgtcggcgccggcaatgccccg
gcctacgtcgacaacaacgtcgacgtgcagcgcgtggcgaacgacctcatcctttcgaag
cacttcgactacggcatgatctgcgccaccgagcaggcgatcatcgcgcacaaggacatc
tacgcgccgctcgtcaaggaattgaagcgccgcaaggcatacttcgtcaacgacgaggag
aaggccaagctcgagaaatacatgttcggctgtaccgcgttctccggcgagaccccgaag
ctcaactccgtggtcccgggcaagtcgccgcagtacatcgcgcacgaagccggcttcgaa
atccccgaggatgccacgatcctcgccgccgaatgctccgaggtgggcgagaacgagccg
ctcaccatggagaagctcgcgccggtgcacgccgtgctcaagttctccgacaaagagcag
ggcttcgagatgtgcgaggagatgctcaagcacggtgccggccataccgccgcgatccac
acgaacaacgacgacctcgtccgtgagtacggcctgcgcatgcacgcctgccgtatcatc
tggaaccagccgagctcactcgggggcatcggcgacatctacaactccatcgccccgtcg
ctcacgctgggctgcggctcctacggcggcaactccgtctccggcaacgtgcaggcgatc
aatctgctcaacatcaagcgaatcgcgcgaaggaacaacaacatgcagtggttcaagatc
ccggcaaagacgtacttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatc
gaacgcgccgtcatcgtgtgcgacaaggtgatggagcagctcggcatcgtcgacaaggtg
atcgaccagctgcgtgcacgctccaaccgcgtcaccttccgcatcgtcgactatgtggag
cctgagccgagcgtcgagaccgtcgagcgcggcgccgccatgatgcgcgacgaattcgag
ccggatacgatcatcgccgtcggcggcggctcgcccatggacgccgcgaagatcatgtgg
ctgctctacgagcatccggaaatcgcgttctccgacgtccgtgagaagttcttcgacatt
cgcaagcgcgccttcaagattccgccgctcggcgccaaggccaagctcgtgtgtatcccg
acctcgtcgggcaccggctccgaggtcacgccgttcgctgtgatcaccgatcacaagacc
ggttacaagtacccgatcaccgattacgcgctcacgccgtccgttgcgatcgtcgacccg
gtgctcgcgcgcacgcagccgcgccgactggcatccgatgccggtttcgatgcgctgacc
cattcgatggaggcctacgtctccgtctatgcgaacgacttcaccgacggtatggcgctg
catgcctgcaagctgatctgggacaaccttgcggagtccgtcaatagcgagccgggcgaa
accaagaagaaggcgcaggagaagatgcacaacgccgcaaccatggccggcatggcattc
ggatccgccttccttggcatgtgccacgccatggcgcacaccatcggcgccctgtgccac
atcgcgcacggccgcacgaactcgattctgctgccatatgtgatccgctacaacgggcag
gtgccggaggagccgacctcctggccgaagtacagcaagtacatcgcgccggagcgttac
caggagctcgcctcgctgctcggggtcgacccgggcaagaccccggccgagggcgtcgag
aatctggcgaaggccgtcgaggactaccgcgacaacaagctcggcatgaacaagagcttc
aaggattgcggtgtggacgaggactacttctggagcatcctcgagcagatcggcatgcgc
gcctacgaagaccagtgcgcgcctgcgaatccgcgcatcccgcagatccaggacatgatg
gatatcgccatcgccgcctactacggcgtctcgcaggctgagggccatgcgatgcgcgtt
gagcgcgaaggtgtgggcgccacggaggaagcctccgagcgcgtctga

DBGET integrated database retrieval system