KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_02550Help
Entry
BANAN_02550       CDS       T02047                                 

Definition
Dihydroneopterin aldolase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bni00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612105..612974
Genome map
AA seq 289 aa AA seqDB search
MTTVDCNGIDLGSNEDDTRVWTADVSWITDDDQLVDAEDLAAHVAAIGQMMLGVPVEQLA
ERIAAQLANQPVFRSVTVTVHMHWKAPLRTFEQLSATVAANRQSSANPSAAAANTGGEES
ASTHDGALPVDPAYHDAVISLRSAAPNAEQLFREVIVTLDSMPGNQVDGISPLYFVGSLN
GTDGHAAVIKLSTAMGTRQLNQVLDALHTAHEGALQLSVVAIGKAGDESLHAPEGAADHH
LGAAVLEPWAAMDPNASYNGDPLAYLLAMAPDSAQVGVESEQWVMGGGR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgtggactgcaacggcatcgacttgggcagcaacgaggacgatacgcgtgtg
tggacggcggacgtcagctggatcaccgacgacgaccagctggtggatgccgaggatctg
gccgcacatgtggcggccatcgggcagatgatgctcggcgtacccgttgagcagcttgcc
gagcgcatcgcggcgcagctggcgaaccaaccggtgttccgctccgtcaccgtcaccgtg
cacatgcattggaaggccccattgcgcaccttcgaacagctcagcgcaacggtcgccgca
aaccggcaatcctcggccaacccatctgcggccgctgcgaataccgggggcgaggaatct
gcaagcacgcatgatggggcattgccggtcgacccggcataccacgatgccgtcatttcc
ttgcgcagtgccgcgccgaatgccgagcagctgttccgtgaggtcatcgtcacgctcgac
agcatgccgggcaaccaagtggacggcatctccccactgtatttcgtgggctcgctcaac
ggaaccgacggccatgccgccgtgatcaaactcagcaccgcaatggggacgcgtcagctg
aatcaggtgctcgatgcgttgcacaccgcacacgagggagccctgcaactgtcggttgtg
gccataggcaaggcgggggatgaatcactgcatgcaccggagggcgcggcggatcatcat
ctcggcgctgccgtgcttgagccgtgggctgccatggatcccaatgccagctataacgga
gacccactggcgtatctgctggcaatggcgcccgacagcgcacaggtgggcgtcgaatcc
gaacagtgggttatgggaggcggtcgatga

DBGET integrated database retrieval system